Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q7Z3B3 KAT8 regulatory NSL complex subunit 1 n=152 Tax=Eutheria TaxID=9347 RepID=KANL1_HUMAN MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGARIIGHISESLSTKSCG ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS QVTASTSQQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKG SPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLG SANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRC STPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAP TSPPIVPLKSRHLVAAATAQRPTHR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 152  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q7Z3B3KANL1_HUMANKAT8 regulatory NSL complex subunit 1Homo sapiens (Human)9606UniRef100_Q7Z3B3
1,105Representative
A0A3Q2GW33A0A3Q2GW33_HORSEKAT8 regulatory NSL complex subunit 1Equus caballus (Horse)9796UniRef100_A0A3Q2GW33
1,111
I3L243I3L243_HUMANKAT8 regulatory NSL complex subunit 1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A3Q2GW33
139
A0A0G2JRW7A0A0G2JRW7_HUMANKAT8 regulatory NSL complex subunit 1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A3Q2GW33
122
A0A480E7M3A0A480E7M3_PIGKAT8 regulatory NSL complex subunit 1 isoform 2Sus scrofa (Pig)9823UniRef100_A0A480E7M3
1,107
A0A024R9Y2A0A024R9Y2_HUMANKIAA1267, isoform CRA_aHomo sapiens (Human)9606UniRef100_A0A024R9Y2
1,105
I3L233I3L233_HUMANKAT8 regulatory NSL complex subunit 1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A024R9Y2
678
A0A0G2JQF4A0A0G2JQF4_HUMANKAT8 regulatory NSL complex subunit 1Homo sapiens (Human)9606UniRef100_A0A0G2JQF4
1,105
A0A0G2JNT7A0A0G2JNT7_HUMANKAT8 regulatory NSL complex subunit 1Homo sapiens (Human)9606UniRef100_A0A0G2JNT7
1,105
F7CBY7F7CBY7_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7CBY7
1,105
A0A2K5URF4A0A2K5URF4_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F7CBY7
1,105
F6XLL4F6XLL4_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7CBY7
139
U3BGU2U3BGU2_CALJAKAT8 regulatory NSL complex subunit 1 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BGU2
1,105
K7A7H6K7A7H6_PANTRKIAA1267Pan troglodytes (Chimpanzee)9598UniRef100_K7A7H6
1,105
A0A2K5CLI9A0A2K5CLI9_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CLI9
1,105
B1AQV9B1AQV9_MOUSEKAT8 regulatory NSL complex subunit 1 (Fragment)Mus musculus (Mouse)10090UniRef100_A0A2K5CLI9
91
A0A2J8J3R7A0A2J8J3R7_PANTRKANSL1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8J3R7
1,105
A0A2J8J3T4A0A2J8J3T4_PANTRKANSL1 isoform 24 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8J3R7
678
A0A2K6TVZ5A0A2K6TVZ5_SAIBBKAT8 regulatory NSL complex subunit 1Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6TVZ5
1,105
A0A2K6BWE1A0A2K6BWE1_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6BWE1
1,105
A0A2J8UYZ1A0A2J8UYZ1_PONABKANSL1 isoform 11Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8UYZ1
1,105
A0A2J8UYZ5A0A2J8UYZ5_PONABKANSL1 isoform 12 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8UYZ1
678
A0A2K5RHU5A0A2K5RHU5_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5RHU5
1,105
A0A096P682A0A096P682_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096P682
1,105
A0A2R9B5E1A0A2R9B5E1_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B5E1
1,105

Sequence

Representative sequenceiLengthMass (Da)Tools
Q7Z3B3

Checksumi: B69D11BC522B9CAD

FASTA1,105121,024
        10         20         30         40         50
MAAMAPALTD AAAEAHHIRF KLAPPSSTLS PGSAENNGNA NILIAANGTK
60 70 80 90 100
RKAIAAEDPS LDFRNNPTKE DLGKLQPLVA SYLCSDVTSV PSKESLKLQG
110 120 130 140 150
VFSKQTVLKS HPLLSQSYEL RAELLGRQPV LEFSLENLRT MNTSGQTALP
160 170 180 190 200
QAPVNGLAKK LTKSSTHSDH DNSTSLNGGK RALTSSALHG GEMGGSESGD
210 220 230 240 250
LKGGMTNCTL PHRSLDVEHT TLYSNNSTAN KSSVNSMEQP ALQGSSRLSP
260 270 280 290 300
GTDSSSNLGG VKLEGKKSPL SSILFSALDS DTRITALLRR QADIESRARR
310 320 330 340 350
LQKRLQVVQA KQVERHIQHQ LGGFLEKTLS KLPNLESLRP RSQLMLTRKA
360 370 380 390 400
EAALRKAASE TTTSEGLSNF LKSNSISEEL ERFTASGIAN LRCSEQAFDS
410 420 430 440 450
DVTDSSSGGE SDIEEEELTR ADPEQRHVPL RRRSEWKWAA DRAAIVSRWN
460 470 480 490 500
WLQAHVSDLE YRIRQQTDIY KQIRANKGLI VLGEVPPPEH TTDLFLPLSS
510 520 530 540 550
EVKTDHGTDK LIESVSQPLE NHGARIIGHI SESLSTKSCG ALRPVNGVIN
560 570 580 590 600
TLQPVLADHI PGDSSDAEEQ LHKKQRLNLV SSSSDGTCVA ARTRPVLSCK
610 620 630 640 650
KRRLVRPNSI VPLSKKVHRN STIRPGCDVN PSCALCGSGS INTMPPEIHY
660 670 680 690 700
EAPLLERLSQ LDSCVHPVLA FPDDVPTSLH FQSMLKSQWQ NKPFDKIKPP
710 720 730 740 750
KKLSLKHRAP MPGSLPDSAR KDRHKLVSSF LTTAKLSHHQ TRPDRTHRQH
760 770 780 790 800
LDDVGAVPMV ERVTAPKAER LLNPPPPVHD PNHSKMRLRD HSSERSEVLK
810 820 830 840 850
HHTDMSSSSY LAATHHPPHS PLVRQLSTSS DSPAPASSSS QVTASTSQQP
860 870 880 890 900
VRRRRGESSF DINNIVIPMS VAATTRVEKL QYKEILTPSW REVDLQSLKG
910 920 930 940 950
SPDEENEEIE DLSDAAFAAL HAKCEEMERA RWLWTTSVPP QRRGSRSYRS
960 970 980 990 1000
SDGRTTPQLG SANPSTPQPA SPDVSSSHSL SEYSHGQSPR SPISPELHSA
1010 1020 1030 1040 1050
PLTPVARDTP RHLASEDTRC STPELGLDEQ SVQPWERRTF PLAHSPQAEC
1060 1070 1080 1090 1100
EDQLDAQERA ARCTRRTSGS KTGRETEAAP TSPPIVPLKS RHLVAAATAQ

RPTHR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again