Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q83I75 50S ribosomal protein L2 n=3 Tax=Tropheryma whipplei TaxID=2039 RepID=RL2_TROW8 MAVRKSNPLTPARRGMSFSDFAEITRATPHKSLLSKLSKTGGRNNHGRITARHIGGGHKR RYRLVDFRRSDKDGVKAKVAHIEYDPNRTARIALLHFLDGAKRYILAPSGLKQGDVVESG SSADIRPGNSLCIRDIPVGTILHAVELRPGQGAKLARSAGSSVRLSAKDGDFAILKLPSG EIRMVSLSCRATIGEVGNGQRLNVSLGKAGRSRWCGVRPSVRGVAMNPVDHPHGGGEGKT SGGRHPVSPWGRPEGKTRRANKPSDRFIIRRKSRKRR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q83I75RL2_TROW850S ribosomal protein L2Tropheryma whipplei (strain TW08/27) (Whipple's bacillus)218496UniRef100_Q83I75
277Representative & Seed
Q83FY9RL2_TROWT50S ribosomal protein L2Tropheryma whipplei (strain Twist) (Whipple's bacillus)203267UniRef100_Q83I75
277
UPI0004B4553950S ribosomal protein L2Tropheryma whipplei (Whipple's bacillus) (Tropheryma whippelii)2039UniRef100_UPI0004B45539
277

Sequence

Representative sequenceiLengthMass (Da)Tools
Q83I75

Checksumi: 9A070AB835084388

FASTA27730,102
        10         20         30         40         50
MAVRKSNPLT PARRGMSFSD FAEITRATPH KSLLSKLSKT GGRNNHGRIT
60 70 80 90 100
ARHIGGGHKR RYRLVDFRRS DKDGVKAKVA HIEYDPNRTA RIALLHFLDG
110 120 130 140 150
AKRYILAPSG LKQGDVVESG SSADIRPGNS LCIRDIPVGT ILHAVELRPG
160 170 180 190 200
QGAKLARSAG SSVRLSAKDG DFAILKLPSG EIRMVSLSCR ATIGEVGNGQ
210 220 230 240 250
RLNVSLGKAG RSRWCGVRPS VRGVAMNPVD HPHGGGEGKT SGGRHPVSPW
260 270
GRPEGKTRRA NKPSDRFIIR RKSRKRR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again