Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q86TJ2 Transcriptional adapter 2-beta n=167 Tax=Sarcopterygii TaxID=8287 RepID=TAD2B_HUMAN MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFT LWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLG KACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQD AETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEK EKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGIT KMEESAEYEAARHKREKRKENKNLAGSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCS SLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 167  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q86TJ2TAD2B_HUMANTranscriptional adapter 2-betaHomo sapiens (Human)9606UniRef100_Q86TJ2
420Representative
Q5RBN9TAD2B_PONABTranscriptional adapter 2-betaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q86TJ2
420
Q6NRB5TAD2B_XENLATranscriptional adapter 2-betaXenopus laevis (African clawed frog)8355UniRef100_Q6NRB5
420
K7ALB6K7ALB6_PANTRTranscriptional adapterPan troglodytes (Chimpanzee)9598UniRef100_Q86TJ2
420
A0A2J8RXJ5A0A2J8RXJ5_PONABTranscriptional adapterPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q86TJ2
420
A0A2R9B1M9A0A2R9B1M9_PANPATranscriptional adapterPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q86TJ2
420
G3RJT4G3RJT4_GORGOTranscriptional adapterGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q86TJ2
375
A0A2J8RXM3A0A2J8RXM3_PONABTADA2B isoform 4Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q86TJ2
328
A0A2J8JX49A0A2J8JX49_PANTRTADA2B isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_Q86TJ2
328
Q86TJ2-3Isoform 3 of TAD2B_HUMAN3Homo sapiens (Human)9606UniRef100_Q86TJ2
328
A0A2R8MXJ1A0A2R8MXJ1_CALJATranscriptional adapterCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MXJ1
510Seed
G7P575G7P575_MACFAADA2-like protein beta (Fragment)Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2R8MXJ1
337
H9F9E2H9F9E2_MACMUTranscriptional adapter 2-beta (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_A0A2R8MXJ1
419
H9ZFG7H9ZFG7_MACMUTranscriptional adapterMacaca mulatta (Rhesus macaque)9544UniRef100_A0A2R8MXJ1
420
U3EXG3U3EXG3_CALJATranscriptional adapterCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MXJ1
420
A0A2K6NXW1A0A2K6NXW1_RHIROTranscriptional adapterRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2R8MXJ1
420
A0A2I3N081A0A2I3N081_PAPANTranscriptional adapterPapio anubis (Olive baboon)9555UniRef100_A0A2R8MXJ1
420
A0A2K5E1T7A0A2K5E1T7_AOTNATranscriptional adapterAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2R8MXJ1
420
A0A0D9RU29A0A0D9RU29_CHLSBTranscriptional adapterChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A2R8MXJ1
420
A0A2K5ZU94A0A2K5ZU94_MANLETranscriptional adapterMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2R8MXJ1
420
A0A2K5TZZ6A0A2K5TZZ6_MACFATranscriptional adapterMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2R8MXJ1
420
A0A2K6MCJ2A0A2K6MCJ2_RHIBETranscriptional adapterRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2R8MXJ1
420
A0A2K6E6Y2A0A2K6E6Y2_MACNETranscriptional adapterMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2R8MXJ1
420
D6RJ05D6RJ05_HUMANTranscriptional adapter 2-beta (Fragment)Homo sapiens (Human)9606UniRef100_A0A2R8MXJ1
129
A0A2J8RXJ4A0A2J8RXJ4_PONABTADA2B isoform 5 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2R8MXJ1
129

Sequence

Representative sequenceiLengthMass (Da)Tools
Q86TJ2

Checksumi: 89C3365128DF5EBC

FASTA42048,470
        10         20         30         40         50
MAELGKKYCV YCLAEVSPLR FRCTECQDIE LCPECFSAGA EIGHHRRYHG
60 70 80 90 100
YQLVDGGRFT LWGPEAEGGW TSREEQLLLD AIEQFGFGNW EDMAAHVGAS
110 120 130 140 150
RTPQEVMEHY VSMYIHGNLG KACIPDTIPN RVTDHTCPSG GPLSPSLTTP
160 170 180 190 200
LPPLDISVAE QQQLGYMPLR DDYEIEYDQD AETLISGLSV NYDDDDVEIE
210 220 230 240 250
LKRAHVDMYV RKLKERQRRK NIARDYNLVP AFLGKDKKEK EKALKRKITK
260 270 280 290 300
EEKELRLKLR PLYQFMSCKE FDDLFENMHK EKMLRAKIRE LQRYRRNGIT
310 320 330 340 350
KMEESAEYEA ARHKREKRKE NKNLAGSKRG KEDGKDSEFA AIENLPGFEL
360 370 380 390 400
LSDREKVLCS SLNLSPARYV TVKTIIIKDH LQKRQGIPSK SRLPSYLDKV
410 420
LKKRILNFLT ESGWISRDAS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again