Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8CFN5-4 Isoform 4 of Myocyte-specific enhancer factor 2C n=309 Tax=Sarcopterygii TaxID=8287 RepID=Isoform 4 of MEF2C_MOUSE MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST DMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYALTPRTEEKYKKINE EFDNMIKSHKIPAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNFLPLAHPSLQRNSM SPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP PMNLGMNNRKPDLRVLIPPGSKNTMPSVSQRINNSQSAQSLATPVVSVATPTLPGQGMGG YPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACT STHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 309  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8CFN5-4Isoform 4 of MEF2C_MOUSE4Mus musculus (Mouse)10090UniRef100_Q8CFN5-4
432Representative
A4UTP7MEF2C_PIGMyocyte-specific enhancer factor 2CSus scrofa (Pig)9823UniRef100_A4UTP7
463
A0A2K6CP52A0A2K6CP52_MACNEMADS-box domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CP52
486
A0A1S2ZGH7A0A1S2ZGH7_ERIEUmyocyte-specific enhancer factor 2C isoform X2Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S2ZGH7
483
U3EHP9U3EHP9_CALJAMyocyte-specific enhancer factor 2C isoform 3Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3EHP9
483
A0A3Q0ELI2A0A3Q0ELI2_TARSYmyocyte-specific enhancer factor 2C isoform X1Tarsius syrichta (Philippine tarsier)1868482UniRef100_U3EHP9
483
A0A2I3TMM0A0A2I3TMM0_PANTRMEF2C isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_U3EHP9
483
A0A2Y9JM62A0A2Y9JM62_ENHLUmyocyte-specific enhancer factor 2C isoform X1Enhydra lutris kenyoni391180UniRef100_U3EHP9
483
A0A3Q7VZU8A0A3Q7VZU8_URSARmyocyte-specific enhancer factor 2C isoform X5Ursus arctos horribilis116960UniRef100_U3EHP9
483
A0A452SBF8A0A452SBF8_URSAMMyocyte enhancer factor 2CUrsus americanus (American black bear) (Euarctos americanus)9643UniRef100_U3EHP9
483
A0A2K6SB04A0A2K6SB04_SAIBBMyocyte enhancer factor 2CSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_U3EHP9
483
A0A2K6F594A0A2K6F594_PROCOMADS-box domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_U3EHP9
483
A0A1D5RIU2A0A1D5RIU2_MACMUMADS-box domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_U3EHP9
483
A0A2K5HR54A0A2K5HR54_COLAPMADS-box domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_U3EHP9
483
A0A2K5PJ66A0A2K5PJ66_CEBCAMADS-box domain-containing proteinCebus capucinus imitator1737458UniRef100_U3EHP9
483
A0A2U3W5I5A0A2U3W5I5_ODOROmyocyte-specific enhancer factor 2C isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_U3EHP9
483
A0A2J8UX26A0A2J8UX26_PONABMEF2C isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_U3EHP9
483
A0A2K5NHU5A0A2K5NHU5_CERATMADS-box domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_U3EHP9
483
A0A2U3YMD2A0A2U3YMD2_LEPWEmyocyte-specific enhancer factor 2C-like isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_U3EHP9
483
A0A2I2U1F3A0A2I2U1F3_FELCAMADS-box domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_U3EHP9
483
A0A2I3NEM1A0A2I3NEM1_PAPANMADS-box domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_U3EHP9
483
A0A2K5F4S0A0A2K5F4S0_AOTNAMADS-box domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_U3EHP9
483
A0A3Q7NMX6A0A3Q7NMX6_CALURmyocyte-specific enhancer factor 2C isoform X5Callorhinus ursinus (Northern fur seal)34884UniRef100_U3EHP9
483
A0A2K5Z352A0A2K5Z352_MANLEMADS-box domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_U3EHP9
483
A0A2I3GSV9A0A2I3GSV9_NOMLEMADS-box domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_U3EHP9
483

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8CFN5-4

Checksumi: 76BA0222D9996114

FASTA46350,249
        10         20         30         40         50
MGRKKIQITR IMDERNRQVT FTKRKFGLMK KAYELSVLCD CEIALIIFNS
60 70 80 90 100
TNKLFQYAST DMDKVLLKYT EYNEPHESRT NSDIVEALNK KENKGCESPD
110 120 130 140 150
PDSSYALTPR TEEKYKKINE EFDNMIKSHK IPAVPPPNFE MPVSIPVSSH
160 170 180 190 200
NSLVYSNPVS SLGNPNFLPL AHPSLQRNSM SPGVTHRPPS AGNTGGLMGG
210 220 230 240 250
DLTSGAGTSA GNGYGNPRNS PGLLVSPGNL NKNMQAKSPP PMNLGMNNRK
260 270 280 290 300
PDLRVLIPPG SKNTMPSVSQ RINNSQSAQS LATPVVSVAT PTLPGQGMGG
310 320 330 340 350
YPSAISTTYG TEYSLSSADL SSLSGFNTAS ALHLGSVTGW QQQHLHNMPP
360 370 380 390 400
SALSQLGACT STHLSQSSNL SLPSTQSLNI KSEPVSPPRD RTTTPSRYPQ
410 420 430 440 450
HTRHEAGRSP VDSLSSCSSS YDGSDREDHR NEFHSPIGLT RPSPDERESP
460
SVKRMRLSEG WAT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again