Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8DS25 50S ribosomal protein L5 n=413 RepID=RL5_STRMU MANRLKEKYLNEVVPALTEKFNYTSVMAVPKVDKIVLNMGVGDAVSNAKNLEKAAAELAL ISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGQRMYEFLDKLVTVSLPRVRDFHGVPT KSFDGRGNYTLGVKEQLIFPEINFDNVDKVRGLDIVIVTTANTDEESRELLTGLGMPFAK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 413  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8DS25RL5_STRMU50S ribosomal protein L5Streptococcus mutans serotype c (strain ATCC 700610 / UA159)210007UniRef100_Q8DS25
180Representative
Q04MM4RL5_STRP250S ribosomal protein L5Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)373153UniRef100_Q04MM4
180
B5E6G7RL5_STRP450S ribosomal protein L5Streptococcus pneumoniae serotype 19F (strain G54)512566UniRef100_Q04MM4
180
C1CAM4RL5_STRP750S ribosomal protein L5Streptococcus pneumoniae (strain 70585)488221UniRef100_Q04MM4
180
B1I8L0RL5_STRPI50S ribosomal protein L5Streptococcus pneumoniae (strain Hungary19A-6)487214UniRef100_Q04MM4
180
B8ZKG9RL5_STRPJ50S ribosomal protein L5Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)561276UniRef100_Q04MM4
180
Q97SV1RL5_STRPN50S ribosomal protein L5Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)170187UniRef100_Q04MM4
180
B2IS52RL5_STRPS50S ribosomal protein L5Streptococcus pneumoniae (strain CGSP14)516950UniRef100_Q04MM4
180
Q8CWV4RL5_STRR650S ribosomal protein L5Streptococcus pneumoniae (strain ATCC BAA-255 / R6)171101UniRef100_Q04MM4
180
C1CC18RL5_STRZJ50S ribosomal protein L5Streptococcus pneumoniae (strain JJA)488222UniRef100_Q04MM4
180
C1CIA9RL5_STRZP50S ribosomal protein L5Streptococcus pneumoniae (strain P1031)488223UniRef100_Q04MM4
180
C1CPA0RL5_STRZT50S ribosomal protein L5Streptococcus pneumoniae (strain Taiwan19F-14)487213UniRef100_Q04MM4
180
Q9A1W2RL5_STRP150S ribosomal protein L5Streptococcus pyogenes serotype M1301447UniRef100_Q9A1W2
180
P0DE56RL5_STRP350S ribosomal protein L5Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)198466UniRef100_Q9A1W2
180
Q5XEC3RL5_STRP650S ribosomal protein L5Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)286636UniRef100_Q9A1W2
180
Q7CNP5RL5_STRP850S ribosomal protein L5Streptococcus pyogenes serotype M18 (strain MGAS8232)186103UniRef100_Q9A1W2
180
Q1JE46RL5_STRPB50S ribosomal protein L5Streptococcus pyogenes serotype M12 (strain MGAS2096)370553UniRef100_Q9A1W2
180
Q1JP05RL5_STRPC50S ribosomal protein L5Streptococcus pyogenes serotype M12 (strain MGAS9429)370551UniRef100_Q9A1W2
180
Q1JJ50RL5_STRPD50S ribosomal protein L5Streptococcus pyogenes serotype M2 (strain MGAS10270)370552UniRef100_Q9A1W2
180
Q1J901RL5_STRPF50S ribosomal protein L5Streptococcus pyogenes serotype M4 (strain MGAS10750)370554UniRef100_Q9A1W2
180
A2RC26RL5_STRPG50S ribosomal protein L5Streptococcus pyogenes serotype M5 (strain Manfredo)160491UniRef100_Q9A1W2
180
Q48VT7RL5_STRPM50S ribosomal protein L5Streptococcus pyogenes serotype M28 (strain MGAS6180)319701UniRef100_Q9A1W2
180
P0DE57RL5_STRPQ50S ribosomal protein L5Streptococcus pyogenes serotype M3 (strain SSI-1)193567UniRef100_Q9A1W2
180
Q3K3V7RL5_STRA150S ribosomal protein L5Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)205921UniRef100_Q3K3V7
180
Q8E7S9RL5_STRA350S ribosomal protein L5Streptococcus agalactiae serotype III (strain NEM316)211110UniRef100_Q3K3V7
180

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8DS25

Checksumi: 93EC0D1D19344A93

FASTA18019,811
        10         20         30         40         50
MANRLKEKYL NEVVPALTEK FNYTSVMAVP KVDKIVLNMG VGDAVSNAKN
60 70 80 90 100
LEKAAAELAL ISGQKPLITK AKKSIAGFRL REGVAIGAKV TLRGQRMYEF
110 120 130 140 150
LDKLVTVSLP RVRDFHGVPT KSFDGRGNYT LGVKEQLIFP EINFDNVDKV
160 170 180
RGLDIVIVTT ANTDEESREL LTGLGMPFAK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again