Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8IVF5-5 Isoform 5 of T-lymphoma invasion and metastasis-inducing protein 2 n=31 Tax=Boreoeutheria TaxID=1437010 RepID=Isoform 5 of TIAM2_HUMAN MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSL ARSCLSHFKSNQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVG HELADNHITSRDCNGHLLNCYGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG GNPSKVPAEDCSEPVQLLRYSPTLASETSPVPEARRGSSADSLPSHRPSPTDSRLRSSKG SSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHASFPPGDAKKPFNQSSSLSSLR ELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDPIQYSSFTLPC RKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETST ETAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWV TLKGCTLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLF QATSQTDLENWVTAVHSACASLFAKKHGKEDTLRLLKNQTKNLLQKIDMDSKMKKMAELQ LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPS KLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKE KRPSITQIFDSSGSHGFSGTQLPQNSSNSSEVDELLHIYGSTVDGVPRDNAWEIQTYVHF QDNHGVTVGIKPEHRVEDILTLACKMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQ VYDEIEVFPLNVYDVQLTKTGSVCDFGFAVTAQVDERQHLSRIFISDVLPDGLAYGEGLR KGNEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLIARPPDTKATLCTSWSDSDLFSRDQK SLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFR SAEQITALCRSFNDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVK DLSCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLET PSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQ HSSTLESYLIKPVQRVLKYPLLLKELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKI YEDYGTVFDQLVAEQSGTEKEVTELSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFK RAVILVYKENCKLKKKLPSNSRPAHNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIW ELIHTKSEIEGRPETIFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRL VPLKNRVPVSAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAE GRQDSKSTSPGKYPHPGLADFADNLIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLR ISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRH QSLDSQSENATIDLNSVLEREFSVQSLTSVVSEECFYETESHGKS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 31  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8IVF5-5Isoform 5 of TIAM2_HUMAN5, LongHomo sapiens (Human)9606UniRef100_Q8IVF5-5
1,725Representative
Q8IVF5-3Isoform 3 of TIAM2_HUMAN3, ShortHomo sapiens (Human)9606UniRef100_Q8IVF5-5
626
A0A2K5LJC3A0A2K5LJC3_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LJC3
1,725
A0A2K5ZVI7A0A2K5ZVI7_MANLET cell lymphoma invasion and metastasis 2Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZVI7
1,725
A0A2I3RL70A0A2I3RL70_PANTRTIAM2 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RL70
1,725
A0A2I3SVW0A0A2I3SVW0_PANTRTIAM2 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RL70
626
A0A2K6RQ36A0A2K6RQ36_RHIROT cell lymphoma invasion and metastasis 2Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RQ36
1,725
F6VAK2F6VAK2_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6VAK2
1,725
H9F6G0H9F6G0_MACMUT-lymphoma invasion and metastasis-inducing protein 2 isoform b (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_F6VAK2
285
G3R907G3R907_GORGOT cell lymphoma invasion and metastasis 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R907
1,725
A0A2I2YQS0A0A2I2YQS0_GORGOT cell lymphoma invasion and metastasis 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R907
626
A0A2R9CL95A0A2R9CL95_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CL95
1,725
A0A2R9CNG1A0A2R9CNG1_PANPADH domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CL95
626
G7P4X2G7P4X2_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7P4X2
1,725
A0A2K6E2R5A0A2K6E2R5_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6E2R5
1,725
A0A2K6E2Q3A0A2K6E2Q3_MACNEDH domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6E2R5
626
G7MQ27G7MQ27_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MQ27
1,725
A0A2K5HQA0A0A2K5HQA0_COLAPT cell lymphoma invasion and metastasis 2Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HQA0
1,725
A0A2J8XAP8A0A2J8XAP8_PONABTIAM2 isoform 12Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XAP8
1,725
A0A2J8XAQ9A0A2J8XAQ9_PONABTIAM2 isoform 19Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XAP8
626
A0A2J8XAM7A0A2J8XAM7_PONABTIAM2 isoform 11 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XAP8
676
A0A096MWJ2A0A096MWJ2_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096MWJ2
1,725
A0A0D9RLE3A0A0D9RLE3_CHLSBT cell lymphoma invasion and metastasis 2Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RLE3
1,725
A0A2K5UAZ9A0A2K5UAZ9_MACFAT cell lymphoma invasion and metastasis 2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UAZ9
1,725
A0A384BW12A0A384BW12_URSMAT-lymphoma invasion and metastasis-inducing protein 2Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384BW12
1,486

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8IVF5-5

Checksumi: A836FE578E412A5C

FASTA1,725192,554
        10         20         30         40         50
MGNSDSQYTL QGSKNHSNTI TGAKQIPCSL KIRGIHAKEE KSLHGWGHGS
60 70 80 90 100
NGAGYKSRSL ARSCLSHFKS NQPYASRLGG PTCKVSRGVA YSTHRTNAPG
110 120 130 140 150
KDFQGISAAF STENGFHSVG HELADNHITS RDCNGHLLNC YGRNESIAST
160 170 180 190 200
PPGEDRKSPR VLIKTLGKLD GCLRVEFHNG GNPSKVPAED CSEPVQLLRY
210 220 230 240 250
SPTLASETSP VPEARRGSSA DSLPSHRPSP TDSRLRSSKG SSLSSESSWY
260 270 280 290 300
DSPWGNAGEL SEAEGSFLAP GMPDPSLHAS FPPGDAKKPF NQSSSLSSLR
310 320 330 340 350
ELYKDANLGS LSPSGIRLSD EYMGTHASLS NRVSFASDID VPSRVAHGDP
360 370 380 390 400
IQYSSFTLPC RKPKAFVEDT AKKDSLKARM RRISDWTGSL SRKKRKLQEP
410 420 430 440 450
RSKEGSDYFD SRSDGLNTDV QGSSQASAFL WSGGSTQILS QRSESTHAIG
460 470 480 490 500
SDPLRQNIYE NFMRELEMSR TNTENIETST ETAESSSESL SSLEQLDLLF
510 520 530 540 550
EKEQGVVRKA GWLFFKPLVT VQKERKLELV ARRKWKQYWV TLKGCTLLFY
560 570 580 590 600
ETYGKNSMDQ SSAPRCALFA EDSIVQSVPE HPKKENVFCL SNSFGDVYLF
610 620 630 640 650
QATSQTDLEN WVTAVHSACA SLFAKKHGKE DTLRLLKNQT KNLLQKIDMD
660 670 680 690 700
SKMKKMAELQ LSVVSDPKNR KAIENQIQQW EQNLEKFHMD LFRMRCYLAS
710 720 730 740 750
LQGGELPNPK SLLAAASRPS KLALGRLGIL SVSSFHALVC SRDDSALRKR
760 770 780 790 800
TLSLTQRGRN KKGIFSSLKG LDTLARKGKE KRPSITQIFD SSGSHGFSGT
810 820 830 840 850
QLPQNSSNSS EVDELLHIYG STVDGVPRDN AWEIQTYVHF QDNHGVTVGI
860 870 880 890 900
KPEHRVEDIL TLACKMRQLE PSHYGLQLRK LVDDNVEYCI PAPYEYMQQQ
910 920 930 940 950
VYDEIEVFPL NVYDVQLTKT GSVCDFGFAV TAQVDERQHL SRIFISDVLP
960 970 980 990 1000
DGLAYGEGLR KGNEIMTLNG EAVSDLDLKQ MEALFSEKSV GLTLIARPPD
1010 1020 1030 1040 1050
TKATLCTSWS DSDLFSRDQK SLLPPPNQSQ LLEEFLDNFK KNTANDFSNV
1060 1070 1080 1090 1100
PDITTGLKRS QTDGTLDQVS HREKMEQTFR SAEQITALCR SFNDSQANGM
1110 1120 1130 1140 1150
EGPRENQDPP PRSLARHLSD ADRLRKVIQE LVDTEKSYVK DLSCLFELYL
1160 1170 1180 1190 1200
EPLQNETFLT QDEMESLFGS LPEMLEFQKV FLETLEDGIS ASSDFNTLET
1210 1220 1230 1240 1250
PSQFRKLLFS LGGSFLYYAD HFKLYSGFCA NHIKVQKVLE RAKTDKAFKA
1260 1270 1280 1290 1300
FLDARNPTKQ HSSTLESYLI KPVQRVLKYP LLLKELVSLT DQESEEHYHL
1310 1320 1330 1340 1350
TEALKAMEKV ASHINEMQKI YEDYGTVFDQ LVAEQSGTEK EVTELSMGEL
1360 1370 1380 1390 1400
LMHSTVSWLN PFLSLGKARK DLELTVFVFK RAVILVYKEN CKLKKKLPSN
1410 1420 1430 1440 1450
SRPAHNSTDL DPFKFRWLIP ISALQVRLGN PAGTENNSIW ELIHTKSEIE
1460 1470 1480 1490 1500
GRPETIFQLC CSDSESKTNI VKVIRSILRE NFRRHIKCEL PLEKTCKDRL
1510 1520 1530 1540 1550
VPLKNRVPVS AKLASSRSLK VLKNSSSNEW TGETGKGTLL DSDEGSLSSG
1560 1570 1580 1590 1600
TQSSGCPTAE GRQDSKSTSP GKYPHPGLAD FADNLIKESD ILSDEDDDHR
1610 1620 1630 1640 1650
QTVKQGSPTK DIEIQFQRLR ISEDPDVHPE AEQQPGPESG EGQKGGEQPK
1660 1670 1680 1690 1700
LVRGHFCPIK RKANSTKRDR GTLLKAQIRH QSLDSQSENA TIDLNSVLER
1710 1720
EFSVQSLTSV VSEECFYETE SHGKS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again