Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8IXQ5 Kelch-like protein 7 n=294 Tax=Euteleostomi TaxID=117571 RepID=KLHL7_HUMAN MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRV VLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDA ANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTD EFLQLDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISK NFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGG SQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKD SWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQR CSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVK DKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVG RLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 294  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8IXQ5KLHL7_HUMANKelch-like protein 7Homo sapiens (Human)9606UniRef100_Q8IXQ5
586Representative
Q5ZI33KLHL7_CHICKKelch-like protein 7Gallus gallus (Chicken)9031UniRef100_Q5ZI33
586
Q5XHZ6KLHL7_RATKelch-like protein 7Rattus norvegicus (Rat)10116UniRef100_Q5XHZ6
586
Q8BUL5KLHL7_MOUSEKelch-like protein 7Mus musculus (Mouse)10090UniRef100_Q8BUL5
586
H2PMN8H2PMN8_PONABKLHL7 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q8IXQ5
586
A0A2I3SVQ9A0A2I3SVQ9_PANTRKLHL7 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q8IXQ5
586
U3CAU3U3CAU3_CALJAKelch-like protein 7 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_Q8IXQ5
586
A0A2K5L3H7A0A2K5L3H7_CERATBTB domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q8IXQ5
586
A0A2K5CQJ9A0A2K5CQJ9_AOTNABTB domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_Q8IXQ5
586
A0A096N0Q8A0A096N0Q8_PAPANBTB domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_Q8IXQ5
586
A0A2R9AFE4A0A2R9AFE4_PANPABTB domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q8IXQ5
586
A0A0D9RNA4A0A0D9RNA4_CHLSBBTB domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_Q8IXQ5
586
G1T839G1T839_RABITBTB domain-containing proteinOryctolagus cuniculus (Rabbit)9986UniRef100_Q8IXQ5
586
A0A2K6LAQ5A0A2K6LAQ5_RHIBEBTB domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q8IXQ5
586
A0A2K6FNC4A0A2K6FNC4_PROCOBTB domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_Q8IXQ5
586
A0A0P6J4P9A0A0P6J4P9_HETGAKelch-like protein 7 isoform 1Heterocephalus glaber (Naked mole rat)10181UniRef100_Q8IXQ5
586
H2QU92H2QU92_PANTRKLHL7 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_Q8IXQ5
538
A0A2J8VE76A0A2J8VE76_PONABKLHL7 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q8IXQ5
538
A0A2K5L3I5A0A2K5L3I5_CERATBTB domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q8IXQ5
538
A0A2R9AL08A0A2R9AL08_PANPABTB domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q8IXQ5
538
A0A2K5Z0L5A0A2K5Z0L5_MANLEBTB domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_Q8IXQ5
538
G1RXE1G1RXE1_NOMLEBTB domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_Q8IXQ5
538
A0A2K6LAP5A0A2K6LAP5_RHIBEBTB domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q8IXQ5
538
A0A2K6CQM1A0A2K6CQM1_MACNEBTB domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_Q8IXQ5
538
A0A2K5JKM2A0A2K5JKM2_COLAPBTB domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_Q8IXQ5
538

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8IXQ5

Checksumi: FA4ED8F1567AC7A8

FASTA58665,992
        10         20         30         40         50
MAASGVEKSS KKKTEKKLAA REEAKLLAGF MGVMNNMRKQ KTLCDVILMV
60 70 80 90 100
QERKIPAHRV VLAAASHFFN LMFTTNMLES KSFEVELKDA EPDIIEQLVE
110 120 130 140 150
FAYTARISVN SNNVQSLLDA ANQYQIEPVK KMCVDFLKEQ VDASNCLGIS
160 170 180 190 200
VLAECLDCPE LKATADDFIH QHFTEVYKTD EFLQLDVKRV THLLNQDTLT
210 220 230 240 250
VRAEDQVYDA AVRWLKYDEP NRQPFMVDIL AKVRFPLISK NFLSKTVQAE
260 270 280 290 300
PLIQDNPECL KMVISGMRYH LLSPEDREEL VDGTRPRRKK HDYRIALFGG
310 320 330 340 350
SQPQSCRYFN PKDYSWTDIR CPFEKRRDAA CVFWDNVVYI LGGSQLFPIK
360 370 380 390 400
RMDCYNVVKD SWYSKLGPPT PRDSLAACAA EGKIYTSGGS EVGNSALYLF
410 420 430 440 450
ECYDTRTESW HTKPSMLTQR CSHGMVEANG LIYVCGGSLG NNVSGRVLNS
460 470 480 490 500
CEVYDPATET WTELCPMIEA RKNHGLVFVK DKIFAVGGQN GLGGLDNVEY
510 520 530 540 550
YDIKLNEWKM VSPMPWKGVT VKCAAVGSIV YVLAGFQGVG RLGHILEYNT
560 570 580
ETDKWVANSK VRAFPVTSCL ICVVDTCGAN EETLET
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again