Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8UVZ0 CCAAT/enhancer-binding protein n=13 Tax=Cyprinidae TaxID=7953 RepID=Q8UVZ0_DANRE MEVAGFYEGDYLAFHSTNASSSPVSDGVCKQPVNGSMTKLHDISEHEKAIDFSIYLDSLP QYQHLASQDESHRHRALGIYSDFLSEENKSKRAALQNYKNYISLTERDPNQLAYPELQET RIDAVFSPDFMGSFAKSNGRHEETPMDGPGGYDMRSYLPYQTAPSGSLGNISTASSSCSS PPGTPAPSGKGRSPQAGGKMTSSGKGKKRLDKDSDEYRQRRERNNLAVRKSRDKAKMRNL ETQHKVLELAAENDRLQKRVEQLSRELATLRNLLSATGQC

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 13 of 13  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8UVZ0Q8UVZ0_DANRECCAAT/enhancer-binding proteinDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q8UVZ0
280Representative
A0A498MMR8A0A498MMR8_LABROCCAAT/enhancer-binding proteinLabeo rohita (Indian major carp) (Cyprinus rohita)84645UniRef100_A0A498MMR8
307Seed
Q7ZU07Q7ZU07_DANRECCAAT/enhancer-binding proteinDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q7ZU07
280
A0A3N0YSS5A0A3N0YSS5_ANAGACCAAT/enhancer-binding protein betaAnabarilius grahami (Kanglang fish) (Barilius grahami)495550UniRef100_A0A3N0YSS5
279
UPI0008FAD446CCAAT/enhancer-binding protein beta-likeCyprinus carpio (Common carp)7962UniRef100_UPI0008FAD446
279
UPI0007AD1B15CCAAT/enhancer-binding protein beta-likeSinocyclocheilus grahami (Dianchi golden-line fish) (Barbus grahami)75366UniRef100_UPI0007AD1B15
278
UPI0007BA1DD0CCAAT/enhancer-binding protein beta-likeSinocyclocheilus rhinocerous307959UniRef100_UPI0007BA1DD0
278
UPI000E4234C1CCAAT/enhancer-binding protein beta-likeCarassius auratus (Goldfish)7957UniRef100_UPI000E4234C1
278
UPI0007BA3373CCAAT/enhancer-binding protein beta-likeSinocyclocheilus anshuiensis1608454UniRef100_UPI0007BA3373
278
UPI0007B8E8C4CCAAT/enhancer-binding protein beta-likeSinocyclocheilus anshuiensis1608454UniRef100_UPI0007B8E8C4
277
UPI0007AD4676CCAAT/enhancer-binding protein beta-likeSinocyclocheilus grahami (Dianchi golden-line fish) (Barbus grahami)75366UniRef100_UPI0007AD4676
277
UPI000E4209CDCCAAT/enhancer-binding protein beta-likeCarassius auratus (Goldfish)7957UniRef100_UPI000E4209CD
276
UPI0008FAD637CCAAT/enhancer-binding protein beta-likeCyprinus carpio (Common carp)7962UniRef100_UPI0008FAD637
276

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8UVZ0

Checksumi: 196A11868C20DDE7

FASTA28031,101
        10         20         30         40         50
MEVAGFYEGD YLAFHSTNAS SSPVSDGVCK QPVNGSMTKL HDISEHEKAI
60 70 80 90 100
DFSIYLDSLP QYQHLASQDE SHRHRALGIY SDFLSEENKS KRAALQNYKN
110 120 130 140 150
YISLTERDPN QLAYPELQET RIDAVFSPDF MGSFAKSNGR HEETPMDGPG
160 170 180 190 200
GYDMRSYLPY QTAPSGSLGN ISTASSSCSS PPGTPAPSGK GRSPQAGGKM
210 220 230 240 250
TSSGKGKKRL DKDSDEYRQR RERNNLAVRK SRDKAKMRNL ETQHKVLELA
260 270 280
AENDRLQKRV EQLSRELATL RNLLSATGQC
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again