Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q8WYR1 Phosphoinositide 3-kinase regulatory subunit 5 n=48 Tax=Boreoeutheria TaxID=1437010 RepID=PI3R5_HUMAN MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE QILQKTREVQEKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN KLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELA SGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDI LQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLS LASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLP QPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRR LENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPW EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLL YYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDG DREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV VKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 48  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8WYR1PI3R5_HUMANPhosphoinositide 3-kinase regulatory subunit 5Homo sapiens (Human)9606UniRef100_Q8WYR1
880Representative
L7RT34L7RT34_HUMANPhosphoinositide-3-kinase, regulatory subunit 5Homo sapiens (Human)9606UniRef100_Q8WYR1
880
Q8WYR1-2Isoform 2 of PI3R5_HUMAN2Homo sapiens (Human)9606UniRef100_Q8WYR1
494
G1RGA1G1RGA1_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1RGA1
889
A0A2J8TFA6A0A2J8TFA6_PONABPIK3R5 isoform 10Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TFA6
884
A0A2J8TFN7A0A2J8TFN7_PONABPIK3R5 isoform 11 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TFA6
44
A0A2J8TFA5A0A2J8TFA5_PONABPIK3R5 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TFA6
494
A0A2R9BCR5A0A2R9BCR5_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BCR5
883
H2NSP7H2NSP7_PONABPhosphoinositide-3-kinase regulatory subunit 5Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NSP7
883
A0A2J8MGP0A0A2J8MGP0_PANTRPIK3R5 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8MGP0
882
A0A2J8MGP6A0A2J8MGP6_PANTRPIK3R5 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8MGP0
494
A0A0D9RDB3A0A0D9RDB3_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RDB3
881
H9Z760H9Z760_MACMUPhosphoinositide 3-kinase regulatory subunit 5Macaca mulatta (Rhesus macaque)9544UniRef100_H9Z760
881
A0A096P2V9A0A096P2V9_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096P2V9
881
G3QJY2G3QJY2_GORGOPhosphoinositide-3-kinase regulatory subunit 5Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QJY2
881
A0A2K5Y1G0A0A2K5Y1G0_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Y1G0
881
A0A2K6E9B6A0A2K6E9B6_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6E9B6
881
A0A2K5NNJ8A0A2K5NNJ8_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NNJ8
880
G7NIQ7G7NIQ7_MACMUPhosphoinositide 3-kinase regulatory subunit 5Macaca mulatta (Rhesus macaque)9544UniRef100_G7NIQ7
880
A0A2K5IGC5A0A2K5IGC5_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IGC5
879
A0A2K6GAR3A0A2K6GAR3_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6GAR3
879
A0A2K5F6K6A0A2K5F6K6_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5F6K6
878
A0A2K6SHV9A0A2K6SHV9_SAIBBPhosphoinositide-3-kinase regulatory subunit 5Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6SHV9
878
A0A2K5P9Y5A0A2K5P9Y5_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5P9Y5
878
A0A3Q7SIR7A0A3Q7SIR7_VULVUphosphoinositide 3-kinase regulatory subunit 5 isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7SIR7
875

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8WYR1

Checksumi: 70E356773B148A8A

FASTA88097,348
        10         20         30         40         50
MQPGATTCTE DRIQHALERC LHGLSLSRRS TSWSAGLCLN CWSLQELVSR
60 70 80 90 100
DPGHFLILLE QILQKTREVQ EKGTYDLLTP LALLFYSTVL CTPHFPPDSD
110 120 130 140 150
LLLKAASTYH RFLTWPVPYC SICQELLTFI DAELKAPGIS YQRLVRAEQG
160 170 180 190 200
LPIRSHRSST VTVLLLNPVE VQAEFLAVAN KLSTPGHSPH SAYTTLLLHA
210 220 230 240 250
FQATFGAHCD VPGLHCRLQA KTLAELEDIF TETAEAQELA SGIGDAAEAR
260 270 280 290 300
RWLRTKLQAV GEKAGFPGVL DTAKPGKLHT IPIPVARCYT YSWSQDSFDI
310 320 330 340 350
LQEILLKEQE LLQPGILGDD EEEEEEEEEV EEDLETDGHC AERDSLLSTS
360 370 380 390 400
SLASHDSTLS LASSQASGPA LSRHLLTSFV SGLSDGMDSG YVEDSEESSS
410 420 430 440 450
EWPWRRGSQE RRGHRRPGQK FIRIYKLFKS TSQLVLRRDS RSLEGSSDTA
460 470 480 490 500
LPLRRAGSLC SPLDEPVSPP SRAQRSRSLP QPKLGTQLPS WLLAPASRPQ
510 520 530 540 550
RRRPFLSGDE DPKASTLRVV VFGSDRISGK VARAYSNLRR LENNRPLLTR
560 570 580 590 600
FFKLQFFYVP VKRSHGTSPG ACPPPRSQTP SPPTDSPRHA SPGELGTTPW
610 620 630 640 650
EESTNDISHY LGMLDPWYER NVLGLMHLPP EVLCQQSLKA EAQALEGSPT
660 670 680 690 700
QLPILADMLL YYCRFAARPV LLQVYQTELT FITGEKTTEI FIHSLELGHS
710 720 730 740 750
AATRAIKASG PGSKRLGIDG DREAVPLTLQ IIYSKGAISG RSRWSNLEKV
760 770 780 790 800
CTSVNLNKAC RKQEELDSSM EALTLNLTEV VKRQNSKSKK GFNQISTSQI
810 820 830 840 850
KVDKVQIIGS NSCPFAVCLD QDERKILQSV VRCEVSPCYK PEKSDLSSPP
860 870 880
QTPPDLPAQA APDLCSLLCL PIMTFSGALP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again