Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q92540 Protein SMG7 n=422 Tax=Amniota TaxID=32524 RepID=SMG7_HUMAN MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDL WNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCR VKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQ LVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEV KTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVI NLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYP LPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFE LQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEV GKLLFITEIPELILEDPSEAKENLILQETSVIESLAADGSPGLKSVLSTSRNLSNNCDTG EKPVVTFKENIKTREVNRDQGRSFPPKEVRRDYSKGITVTKNDGKKDNNKRKTETKKCTL EKLQETGKQNVAVQVKSQTELRKTPVSEARKTPVTQTPTQASNSQFIPIHHPGAFPPLPS RPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTAHSPAGNQVQAGKQSHIPYSQ QRPSGPGPMNQGPQQSQPPSQQPLTSLPAQPTAQSTSQLQVQALTQQQQSPTKAVPALGK SPPHHSGFQQYQQADASKQLWNPPQVQGPLGKIMPVKQPYYLQTQDPIKLFEPSLQPPVM QQQPLEKKMKPFPMEPYNHNPSEVKVPEFYWDSSYSMADNRSVMAQQANIDRRGKRSPGV FRPEQDPVPRMPFEKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMFNEVYGKNLTS SSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPASQSPHSSNPSSLPSSPPTHN HNSVPFSNFGPIGTPDNRDRRTADRWKTDKPAMGGFGIDYLSATSSSESSWHQASTPSGT WTGHGPSMEDSSAVLMESLKSIWSSSMMHPGPSALEQLLMQQKQKQQRGQGTMNPPH

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 422  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q92540SMG7_HUMANProtein SMG7Homo sapiens (Human)9606UniRef100_Q92540
1,137Representative
A0A384CXY3A0A384CXY3_URSMAprotein SMG7 isoform X2Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384CXY3
1,215
A0A3Q7WIV5A0A3Q7WIV5_URSARprotein SMG7 isoform X1Ursus arctos horribilis116960UniRef100_A0A384CXY3
1,215
A0A2U3ZCA3A0A2U3ZCA3_ODOROprotein SMG7 isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3ZCA3
1,215
A0A2U3VP66A0A2U3VP66_ODOROprotein SMG7 isoform X2Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3ZCA3
1,144
A0A2Y9GH23A0A2Y9GH23_NEOSCprotein SMG7 isoform X3Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9GH23
1,215
A0A2U3XCL5A0A2U3XCL5_LEPWEprotein SMG7 isoform X2Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2Y9GH23
1,144
A0A3Q7PTN7A0A3Q7PTN7_CALURprotein SMG7 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PTN7
1,215
A0A3Q7TP52A0A3Q7TP52_VULVUprotein SMG7 isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7TP52
1,215
A0A485PUD1A0A485PUD1_LYNPALow quality protein: proteinLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485PUD1
1,211
A0A5A9QHH0A0A5A9QHH0_9CETAUncharacterized proteinBos mutus (wild yak)72004UniRef100_A0A5A9QHH0
1,194
A0A485PLT6A0A485PLT6_LYNPALow quality protein: proteinLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485PLT6
1,192
A0A2K5DIC0A0A2K5DIC0_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DIC0
1,186
A0A3Q7SN24A0A3Q7SN24_VULVUprotein SMG7 isoform X2Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7SN24
1,186
A0A3Q7PI65A0A3Q7PI65_CALURprotein SMG7 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PI65
1,186
A0A3Q7VV58A0A3Q7VV58_URSARprotein SMG7 isoform X2Ursus arctos horribilis116960UniRef100_A0A3Q7VV58
1,186
F7A748F7A748_CALJAUncharacterized proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7A748
1,185
A0A337S0C6A0A337S0C6_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A337S0C6
1,177
A0A2K6EQY7A0A2K6EQY7_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6EQY7
1,177
A0A2K6EQZ9A0A2K6EQZ9_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6EQZ9
1,170
A0A3Q7XQ14A0A3Q7XQ14_URSARprotein SMG7 isoform X3Ursus arctos horribilis116960UniRef100_A0A3Q7XQ14
1,169
A0A452UNF2A0A452UNF2_URSMAUncharacterized proteinUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A3Q7XQ14
1,098
A0A2U3XCL2A0A2U3XCL2_LEPWEprotein SMG7 isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3XCL2
1,169
F1PF83F1PF83_CANLFSMG7 nonsense mediated mRNA decay factorCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_F1PF83
1,169
A0A3Q7T8F6A0A3Q7T8F6_VULVUprotein SMG7 isoform X3Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7T8F6
1,169

Sequence

Representative sequenceiLengthMass (Da)Tools
Q92540

Checksumi: E152AFAFEF8F3A42

FASTA1,137127,281
        10         20         30         40         50
MSLQSAQYLR QAEVLKADMT DSKLGPAEVW TSRQALQDLY QKMLVTDLEY
60 70 80 90 100
ALDKKVEQDL WNHAFKNQIT TLQGQAKNRA NPNRSEVQAN LSLFLEAASG
110 120 130 140 150
FYTQLLQELC TVFNVDLPCR VKSSQLGIIS NKQTHTSAIV KPQSSSCSYI
160 170 180 190 200
CQHCLVHLGD IARYRNQTSQ AESYYRHAAQ LVPSNGQPYN QLAILASSKG
210 220 230 240 250
DHLTTIFYYC RSIAVKFPFP AASTNLQKAL SKALESRDEV KTKWGVSDFI
260 270 280 290 300
KAFIKFHGHV YLSKSLEKLS PLREKLEEQF KRLLFQKAFN SQQLVHVTVI
310 320 330 340 350
NLFQLHHLRD FSNETEQHTY SQDEQLCWTQ LLALFMSFLG ILCKCPLQNE
360 370 380 390 400
SQEESYNAYP LPAVKVSMDW LRLRPRVFQE AVVDERQYIW PWLISLLNSF
410 420 430 440 450
HPHEEDLSSI SATPLPEEFE LQGFLALRPS FRNLDFSKGH QGITGDKEGQ
460 470 480 490 500
QRRIRQQRLI SIGKWIADNQ PRLIQCENEV GKLLFITEIP ELILEDPSEA
510 520 530 540 550
KENLILQETS VIESLAADGS PGLKSVLSTS RNLSNNCDTG EKPVVTFKEN
560 570 580 590 600
IKTREVNRDQ GRSFPPKEVR RDYSKGITVT KNDGKKDNNK RKTETKKCTL
610 620 630 640 650
EKLQETGKQN VAVQVKSQTE LRKTPVSEAR KTPVTQTPTQ ASNSQFIPIH
660 670 680 690 700
HPGAFPPLPS RPGFPPPTYV IPPPVAFSMG SGYTFPAGVS VPGTFLQPTA
710 720 730 740 750
HSPAGNQVQA GKQSHIPYSQ QRPSGPGPMN QGPQQSQPPS QQPLTSLPAQ
760 770 780 790 800
PTAQSTSQLQ VQALTQQQQS PTKAVPALGK SPPHHSGFQQ YQQADASKQL
810 820 830 840 850
WNPPQVQGPL GKIMPVKQPY YLQTQDPIKL FEPSLQPPVM QQQPLEKKMK
860 870 880 890 900
PFPMEPYNHN PSEVKVPEFY WDSSYSMADN RSVMAQQANI DRRGKRSPGV
910 920 930 940 950
FRPEQDPVPR MPFEKSLLEK PSELMSHSSS FLSLTGFSLN QERYPNNSMF
960 970 980 990 1000
NEVYGKNLTS SSKAELSPSM APQETSLYSL FEGTPWSPSL PASSDHSTPA
1010 1020 1030 1040 1050
SQSPHSSNPS SLPSSPPTHN HNSVPFSNFG PIGTPDNRDR RTADRWKTDK
1060 1070 1080 1090 1100
PAMGGFGIDY LSATSSSESS WHQASTPSGT WTGHGPSMED SSAVLMESLK
1110 1120 1130
SIWSSSMMHP GPSALEQLLM QQKQKQQRGQ GTMNPPH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again