Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q92540-4 Isoform 4 of Protein SMG7 n=139 Tax=Eutheria TaxID=9347 RepID=Isoform 4 of SMG7_HUMAN MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDL WNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCR VKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQ LVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEV KTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVI NLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYP LPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFE LQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEV GKLLFITEIPELILEDPSEAKENLILQETSVIESLAADGSPGLKSVLSTSRNLSNNCDTG EKPVVTFKENIKTREVNRDQGRSFPPKEVKSQTELRKTPVSEARKTPVTQTPTQASNSQF IPIHHPGAFPPLPSRPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTAHSPAGN QVQAGKQSHIPYSQQRPSGPGPMNQGPQQSQPPSQQPLTSLPAQPTAQSTSQLQVQALTQ QQQSPTKAVPALGKSPPHHSGFQQYQQADASKQLWNPPQVQGPLGKIMPVKQPYYLQTQD PIKLFEPSLQPPVMQQQPLEKKMKPFPMEPYNHNPSEVKVPEFYWDSSYSMADNRSVMAQ QANIDRRGKRSPGVFRPEQDPVPRMPFEDPKSSPLLPPDLLKSLAALEEEEELIFSNPPD LYPALLGPLASLPGRSLFKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMFNEVYGK NLTSSSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPASQSPHSSNPSSLPSSP PTHNHNSVPFSNFGPIGTPDNRDRRTADRWKTDKPAMGGFGIDYLSATSSSESSWHQAST PSGTWTGHGPSMEDSSAVLMESLKKQQHGVQQLGPKRQSEEEGSSSICVAHRGPRPLPSC SLPASTFRVKFKAARTCAHQAQKKTRRRPFWKRRKKGK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 139  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q92540-4Isoform 4 of SMG7_HUMAN4Homo sapiens (Human)9606UniRef100_Q92540-4
1,178Representative
B1ALB4B1ALB4_HUMANProtein SMG7 (Fragment)Homo sapiens (Human)9606UniRef100_Q92540-4
756
Q96N31Q96N31_HUMANcDNA FLJ31473 fis, clone NT2NE2001530 (Fragment)Homo sapiens (Human)9606UniRef100_Q92540-4
799
A0A091D5K4A0A091D5K4_FUKDAProtein SMG7Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_A0A091D5K4
1,339Seed
A0A1S3WC43A0A1S3WC43_ERIEUprotein SMG7 isoform X1Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S3WC43
1,188
A0A1S2ZSH6A0A1S2ZSH6_ERIEUprotein SMG7 isoform X2Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S3WC43
1,146
A0A4V5P8K1A0A4V5P8K1_MONMOUncharacterized proteinMonodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_A0A4V5P8K1
1,184
A0A340WTE6A0A340WTE6_LIPVEprotein SMG7 isoform X2Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WTE6
1,180
A0A2I3TB56A0A2I3TB56_PANTRSMG7 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TB56
1,178
A0A2J8N6K3A0A2J8N6K3_PANTRSMG7 isoform 9 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TB56
757
F7HCS2F7HCS2_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7HCS2
1,178
A0A2I3MDV7A0A2I3MDV7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MDV7
1,178
G7MF37G7MF37_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MF37
1,178
F7HCX4F7HCX4_CALJAUncharacterized proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7HCX4
1,176
A0A2K5DI88A0A2K5DI88_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DI88
1,176
A0A383ZJD2A0A383ZJD2_BALASprotein SMG7 isoform X4Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383ZJD2
1,170
A0A3Q0DER7A0A3Q0DER7_TARSYprotein SMG7 isoform X3Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A3Q0DER7
1,170
A0A3Q0DM66A0A3Q0DM66_TARSYprotein SMG7 isoform X9Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A3Q0DER7
806
A0A2Y9TIY6A0A2Y9TIY6_PHYMCprotein SMG7 isoform X4Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9TIY6
1,170
A0A2U4CQW6A0A2U4CQW6_TURTRprotein SMG7 isoform X6Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U4CQW6
1,170
A0A3Q1MBG8A0A3Q1MBG8_BOVINSMG7 nonsense mediated mRNA decay factorBos taurus (Bovine)9913UniRef100_A0A3Q1MBG8
1,170
A0A4W2CA34A0A4W2CA34_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A3Q1MBG8
1,170
A0A3Q2L5D0A0A3Q2L5D0_HORSESMG7, nonsense mediated mRNA decay factorEquus caballus (Horse)9796UniRef100_A0A3Q2L5D0
1,170
I3LJF6I3LJF6_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_I3LJF6
1,170
A0A341AE25A0A341AE25_9CETAprotein SMG7 isoform X4Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341AE25
1,170

Sequence

Representative sequenceiLengthMass (Da)Tools
Q92540-4

Checksumi: 2087382714FE3D57

FASTA1,178131,650
        10         20         30         40         50
MSLQSAQYLR QAEVLKADMT DSKLGPAEVW TSRQALQDLY QKMLVTDLEY
60 70 80 90 100
ALDKKVEQDL WNHAFKNQIT TLQGQAKNRA NPNRSEVQAN LSLFLEAASG
110 120 130 140 150
FYTQLLQELC TVFNVDLPCR VKSSQLGIIS NKQTHTSAIV KPQSSSCSYI
160 170 180 190 200
CQHCLVHLGD IARYRNQTSQ AESYYRHAAQ LVPSNGQPYN QLAILASSKG
210 220 230 240 250
DHLTTIFYYC RSIAVKFPFP AASTNLQKAL SKALESRDEV KTKWGVSDFI
260 270 280 290 300
KAFIKFHGHV YLSKSLEKLS PLREKLEEQF KRLLFQKAFN SQQLVHVTVI
310 320 330 340 350
NLFQLHHLRD FSNETEQHTY SQDEQLCWTQ LLALFMSFLG ILCKCPLQNE
360 370 380 390 400
SQEESYNAYP LPAVKVSMDW LRLRPRVFQE AVVDERQYIW PWLISLLNSF
410 420 430 440 450
HPHEEDLSSI SATPLPEEFE LQGFLALRPS FRNLDFSKGH QGITGDKEGQ
460 470 480 490 500
QRRIRQQRLI SIGKWIADNQ PRLIQCENEV GKLLFITEIP ELILEDPSEA
510 520 530 540 550
KENLILQETS VIESLAADGS PGLKSVLSTS RNLSNNCDTG EKPVVTFKEN
560 570 580 590 600
IKTREVNRDQ GRSFPPKEVK SQTELRKTPV SEARKTPVTQ TPTQASNSQF
610 620 630 640 650
IPIHHPGAFP PLPSRPGFPP PTYVIPPPVA FSMGSGYTFP AGVSVPGTFL
660 670 680 690 700
QPTAHSPAGN QVQAGKQSHI PYSQQRPSGP GPMNQGPQQS QPPSQQPLTS
710 720 730 740 750
LPAQPTAQST SQLQVQALTQ QQQSPTKAVP ALGKSPPHHS GFQQYQQADA
760 770 780 790 800
SKQLWNPPQV QGPLGKIMPV KQPYYLQTQD PIKLFEPSLQ PPVMQQQPLE
810 820 830 840 850
KKMKPFPMEP YNHNPSEVKV PEFYWDSSYS MADNRSVMAQ QANIDRRGKR
860 870 880 890 900
SPGVFRPEQD PVPRMPFEDP KSSPLLPPDL LKSLAALEEE EELIFSNPPD
910 920 930 940 950
LYPALLGPLA SLPGRSLFKS LLEKPSELMS HSSSFLSLTG FSLNQERYPN
960 970 980 990 1000
NSMFNEVYGK NLTSSSKAEL SPSMAPQETS LYSLFEGTPW SPSLPASSDH
1010 1020 1030 1040 1050
STPASQSPHS SNPSSLPSSP PTHNHNSVPF SNFGPIGTPD NRDRRTADRW
1060 1070 1080 1090 1100
KTDKPAMGGF GIDYLSATSS SESSWHQAST PSGTWTGHGP SMEDSSAVLM
1110 1120 1130 1140 1150
ESLKKQQHGV QQLGPKRQSE EEGSSSICVA HRGPRPLPSC SLPASTFRVK
1160 1170
FKAARTCAHQ AQKKTRRRPF WKRRKKGK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again