Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q92614 Unconventional myosin-XVIIIa n=334 Tax=Eutheria TaxID=9347 RepID=MY18A_HUMAN MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL EISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQR AAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHP GPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTM LDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSG DSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGF SLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESS VLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQT AYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLE AFGNSPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYY LLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQK ACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKG GTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQH SLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENI ELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLER LFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPR LLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKS LCIQMKLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHC EAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNY IVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACR GYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKD EEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERL RAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVR EVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQ DTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQ QLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDE QAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYE DKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAP SKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQRE KNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQAL QSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERD QRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQA DLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRV DGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYL SDSDTEAKLTETNA

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 334  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q92614MY18A_HUMANUnconventional myosin-XVIIIaHomo sapiens (Human)9606UniRef100_Q92614
2,054Representative
A0A3Q2HTL6A0A3Q2HTL6_HORSEMyosin XVIIIAEquus caballus (Horse)9796UniRef100_A0A3Q2HTL6
2,432
A0A2K5L9J4A0A2K5L9J4_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5L9J4
2,429
A0A3Q2I0Z1A0A3Q2I0Z1_HORSEMyosin XVIIIAEquus caballus (Horse)9796UniRef100_A0A3Q2I0Z1
2,428
A0A1D5QF42A0A1D5QF42_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QF42
2,427
A0A2I2U437A0A2I2U437_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A2I2U437
2,420
A0A3Q2ICX5A0A3Q2ICX5_HORSEMyosin XVIIIAEquus caballus (Horse)9796UniRef100_A0A3Q2ICX5
2,417
F6WYZ5F6WYZ5_CALJAMyosin XVIIIACallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6WYZ5
2,055
A0A1S3W852A0A1S3W852_ERIEUunconventional myosin-XVIIIa isoform X1Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S3W852
2,055
U3EVV6U3EVV6_CALJAUnconventional myosin-XVIIIa isoform aCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3EVV6
2,055
U3BYE8U3BYE8_CALJAUnconventional myosin-XVIIIa isoform aCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BYE8
2,055
A0A2K6T9K2A0A2K6T9K2_SAIBBMyosin XVIIIASaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6T9K2
2,054
A0A2J8TMT0A0A2J8TMT0_PONABMYO18A isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TMT0
2,054
A0A2J8LIG4A0A2J8LIG4_PANTRMYO18A isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LIG4
2,054
A0A341AMM2A0A341AMM2_9CETAunconventional myosin-XVIIIa isoform X3Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341AMM2
2,054
G7NGR7G7NGR7_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7NGR7
2,054
A0A2Y9JWP9A0A2Y9JWP9_ENHLUunconventional myosin-XVIIIa isoform X1Enhydra lutris kenyoni391180UniRef100_A0A2Y9JWP9
2,054
F6Y037F6Y037_CANLFMyosin XVIIIACanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_F6Y037
2,054
A0A1S3F7U9A0A1S3F7U9_DIPORunconventional myosin-XVIIIa isoform X2Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3F7U9
2,054
H9ETY4H9ETY4_MACMUMyosin-XVIIIa isoform aMacaca mulatta (Rhesus macaque)9544UniRef100_H9ETY4
2,054
A0A2K6CE35A0A2K6CE35_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_H9ETY4
2,054
A0A2K6AI46A0A2K6AI46_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K6AI46
2,054
A0A2I2YUD7A0A2I2YUD7_GORGOMyosin XVIIIAGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YUD7
2,054
A0A2K5L9D1A0A2K5L9D1_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5L9D1
2,054
G1LCL1G1LCL1_AILMEUncharacterized proteinAiluropoda melanoleuca (Giant panda)9646UniRef100_G1LCL1
2,054

Sequence

Representative sequenceiLengthMass (Da)Tools
Q92614

Checksumi: 52BFA0AA273E18F7

FASTA2,054233,113
        10         20         30         40         50
MFNLMKKDKD KDGGRKEKKE KKEKKERMSA AELRSLEEMS LRRGFFNLNR
60 70 80 90 100
SSKRESKTRL EISNPIPIKV ASGSDLHLTD IDSDSNRGSV ILDSGHLSTA
110 120 130 140 150
SSSDDLKGEE GSFRGSVLQR AAKFGSLAKQ NSQMIVKRFS FSQRSRDESA
160 170 180 190 200
SETSTPSEHS AAPSPQVEVR TLEGQLVQHP GPGIPRPGHR SRAPELVTKK
210 220 230 240 250
FPVDLRLPPV VPLPPPTLRE LELQRRPTGD FGFSLRRTTM LDRGPEGQAC
260 270 280 290 300
RRVVHFAEPG AGTKDLALGL VPGDRLVEIN GHNVESKSRD EIVEMIRQSG
310 320 330 340 350
DSVRLKVQPI PELSELSRSW LRSGEGPRRE PSDAKTEEQI AAEEAWNETE
360 370 380 390 400
KVWLVHRDGF SLASQLKSEE LNLPEGKVRV KLDHDGAILD VDEDDVEKAN
410 420 430 440 450
APSCDRLEDL ASLVYLNESS VLHTLRQRYG ASLLHTYAGP SLLVLGPRGA
460 470 480 490 500
PAVYSEKVMH MFKGCRREDM APHIYAVAQT AYRAMLMSRQ DQSIILLGSS
510 520 530 540 550
GSGKTTSCQH LVQYLATIAG ISGNKVFSVE KWQALYTLLE AFGNSPTIIN
560 570 580 590 600
GNATRFSQIL SLDFDQAGQV ASASIQTMLL EKLRVARRPA SEATFNVFYY
610 620 630 640 650
LLACGDGTLR TELHLNHLAE NNVFGIVPLA KPEEKQKAAQ QFSKLQAAMK
660 670 680 690 700
VLGISPDEQK ACWFILAAIY HLGAAGATKE AAEAGRKQFA RHEWAQKAAY
710 720 730 740 750
LLGCSLEELS SAIFKHQHKG GTLQRSTSFR QGPEESGLGD GTGPKLSALE
760 770 780 790 800
CLEGMAAGLY SELFTLLVSL VNRALKSSQH SLCSMMIVDT PGFQNPEQGG
810 820 830 840 850
SARGASFEEL CHNYTQDRLQ RLFHERTFVQ ELERYKEENI ELAFDDLEPP
860 870 880 890 900
TDDSVAAVDQ ASHQSLVRSL ARTDEARGLL WLLEEEALVP GASEDTLLER
910 920 930 940 950
LFSYYGPQEG DKKGQSPLLH SSKPHHFLLG HSHGTNWVEY NVTGWLNYTK
960 970 980 990 1000
QNPATQNAPR LLQDSQKKII SNLFLGRAGS ATVLSGSIAG LEGGSQLALR
1010 1020 1030 1040 1050
RATSMRKTFT TGMAAVKKKS LCIQMKLQVD ALIDTIKKSK LHFVHCFLPV
1060 1070 1080 1090 1100
AEGWAGEPRS ASSRRVSSSS ELDLPSGDHC EAGLLQLDVP LLRTQLRGSR
1110 1120 1130 1140 1150
LLDAMRMYRQ GYPDHMVFSE FRRRFDVLAP HLTKKHGRNY IVVDERRAVE
1160 1170 1180 1190 1200
ELLECLDLEK SSCCMGLSRV FFRAGTLARL EEQRDEQTSR NLTLFQAACR
1210 1220 1230 1240 1250
GYLARQHFKK RKIQDLAIRC VQKNIKKNKG VKDWPWWKLF TTVRPLIEVQ
1260 1270 1280 1290 1300
LSEEQIRNKD EEIQQLRSKL EKAEKERNEL RLNSDRLESR ISELTSELTD
1310 1320 1330 1340 1350
ERNTGESASQ LLDAETAERL RAEKEMKELQ TQYDALKKQM EVMEMEVMEA
1360 1370 1380 1390 1400
RLIRAAEING EVDDDDAGGE WRLKYERAVR EVDFTKKRLQ QEFEDKLEVE
1410 1420 1430 1440 1450
QQNKRQLERR LGDLQADSEE SQRALQQLKK KCQRLTAELQ DTKLHLEGQQ
1460 1470 1480 1490 1500
VRNHELEKKQ RRFDSELSQA HEEAQREKLQ REKLQREKDM LLAEAFSLKQ
1510 1520 1530 1540 1550
QLEEKDMDIA GFTQKVVSLE AELQDISSQE SKDEASLAKV KKQLRDLEAK
1560 1570 1580 1590 1600
VKDQEEELDE QAGTIQMLEQ AKLRLEMEME RMRQTHSKEM ESRDEEVEEA
1610 1620 1630 1640 1650
RQSCQKKLKQ MEVQLEEEYE DKQKVLREKR ELEGKLATLS DQVNRRDFES
1660 1670 1680 1690 1700
EKRLRKDLKR TKALLADAQL MLDHLKNSAP SKREIAQLKN QLEESEFTCA
1710 1720 1730 1740 1750
AAVKARKAME VEIEDLHLQI DDIAKAKTAL EEQLSRLQRE KNEIQNRLEE
1760 1770 1780 1790 1800
DQEDMNELMK KHKAAVAQAS RDLAQINDLQ AQLEEANKEK QELQEKLQAL
1810 1820 1830 1840 1850
QSQVEFLEQS MVDKSLVSRQ EAKIRELETR LEFERTQVKR LESLASRLKE
1860 1870 1880 1890 1900
NMEKLTEERD QRIAAENREK EQNKRLQRQL RDTKEEMGEL ARKEAEASRK
1910 1920 1930 1940 1950
KHELEMDLES LEAANQSLQA DLKLAFKRIG DLQAAIEDEM ESDENEDLIN
1960 1970 1980 1990 2000
SLQDMVTKYQ KRKNKLEGDS DVDSELEDRV DGVKSWLSKN KGPSKAASDD
2010 2020 2030 2040 2050
GSLKSSSPTS YWKSLAPDRS DDEHDPLDNT SRPRYSHSYL SDSDTEAKLT

ETNA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again