Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q92614-3 Isoform 3 of Unconventional myosin-XVIIIa n=24 Tax=Eutheria TaxID=9347 RepID=Isoform 3 of MY18A_HUMAN MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL EISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQR AAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHP GPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTM LDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSG DSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGF SLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESS VLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQT AYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLE AFGNSPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYY LLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQK ACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKG GTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQH SLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENI ELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLER LFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPR LLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKS LCIQMKLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHC EAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNY IVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACR GYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKD EEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERL RAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVR EVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQ DTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQ QLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDE QAGTIQMLEQLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKD LKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLH LQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQIN DLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQ VKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEA SRKKHELEMDLESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLINSEGDSDV DSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSR PRYSHSYLSDSDTEAKLTETNA

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q92614-3Isoform 3 of MY18A_HUMAN3Homo sapiens (Human)9606UniRef100_Q92614-3
2,002Representative
F6RFW6F6RFW6_CALJAMyosin XVIIIACallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6RFW6
2,003Seed
A0A2K6T9Q3A0A2K6T9Q3_SAIBBMyosin XVIIIASaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6T9Q3
2,002
A0A2K5PES2A0A2K5PES2_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5PES2
2,002
A0A2K5HWF4A0A2K5HWF4_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HWF4
2,002
A0A3Q0E4X0A0A3Q0E4X0_TARSYunconventional myosin-XVIIIa isoform X5Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A3Q0E4X0
2,002
A0A2Y9JVX8A0A2Y9JVX8_ENHLUunconventional myosin-XVIIIa isoform X7Enhydra lutris kenyoni391180UniRef100_A0A2Y9JVX8
2,002
A0A2J8TMR8A0A2J8TMR8_PONABMYO18A isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TMR8
2,002
A0A2J8LIG8A0A2J8LIG8_PANTRMYO18A isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LIG8
2,002
A0A2K5L9F7A0A2K5L9F7_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5L9F7
2,002
M3W6Z9M3W6Z9_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3W6Z9
2,002
A0A2I3NIB9A0A2I3NIB9_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3NIB9
2,002
A0A2K6AI65A0A2K6AI65_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K6AI65
2,002
A0A2I2Z5L0A0A2I2Z5L0_GORGOMyosin XVIIIAGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z5L0
2,002
A0A2K5W8F4A0A2K5W8F4_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5W8F4
2,002
A0A2K6N4P7A0A2K6N4P7_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6N4P7
2,002
A0A2K6CE60A0A2K6CE60_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CE60
2,002
A0A287D5M9A0A287D5M9_ICTTRUncharacterized proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_A0A287D5M9
2,000
A0A286X9N2A0A286X9N2_CAVPOUncharacterized proteinCavia porcellus (Guinea pig)10141UniRef100_A0A286X9N2
1,998
Q9JMH9-4Isoform 4 of MY18A_MOUSE4Mus musculus (Mouse)10090UniRef100_Q9JMH9-4
1,998
A0A1D5RI78A0A1D5RI78_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RI78
1,988
UPI00045DA2DFunconventional myosin-XVIIIa isoform X3Orycteropus afer afer1230840UniRef100_UPI00045DA2DF
2,002
UPI00105AC8F1unconventional myosin-XVIIIa isoform X5Phyllostomus discolor (pale spear-nosed bat)89673UniRef100_UPI00105AC8F1
2,002
UPI000A30A8A2unconventional myosin-XVIIIa isoform X9Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A30A8A2
2,000

Sequence

Representative sequenceiLengthMass (Da)Tools
Q92614-3

Checksumi: 89350E07C2CF8B03

FASTA2,002226,688
        10         20         30         40         50
MFNLMKKDKD KDGGRKEKKE KKEKKERMSA AELRSLEEMS LRRGFFNLNR
60 70 80 90 100
SSKRESKTRL EISNPIPIKV ASGSDLHLTD IDSDSNRGSV ILDSGHLSTA
110 120 130 140 150
SSSDDLKGEE GSFRGSVLQR AAKFGSLAKQ NSQMIVKRFS FSQRSRDESA
160 170 180 190 200
SETSTPSEHS AAPSPQVEVR TLEGQLVQHP GPGIPRPGHR SRAPELVTKK
210 220 230 240 250
FPVDLRLPPV VPLPPPTLRE LELQRRPTGD FGFSLRRTTM LDRGPEGQAC
260 270 280 290 300
RRVVHFAEPG AGTKDLALGL VPGDRLVEIN GHNVESKSRD EIVEMIRQSG
310 320 330 340 350
DSVRLKVQPI PELSELSRSW LRSGEGPRRE PSDAKTEEQI AAEEAWNETE
360 370 380 390 400
KVWLVHRDGF SLASQLKSEE LNLPEGKVRV KLDHDGAILD VDEDDVEKAN
410 420 430 440 450
APSCDRLEDL ASLVYLNESS VLHTLRQRYG ASLLHTYAGP SLLVLGPRGA
460 470 480 490 500
PAVYSEKVMH MFKGCRREDM APHIYAVAQT AYRAMLMSRQ DQSIILLGSS
510 520 530 540 550
GSGKTTSCQH LVQYLATIAG ISGNKVFSVE KWQALYTLLE AFGNSPTIIN
560 570 580 590 600
GNATRFSQIL SLDFDQAGQV ASASIQTMLL EKLRVARRPA SEATFNVFYY
610 620 630 640 650
LLACGDGTLR TELHLNHLAE NNVFGIVPLA KPEEKQKAAQ QFSKLQAAMK
660 670 680 690 700
VLGISPDEQK ACWFILAAIY HLGAAGATKE AAEAGRKQFA RHEWAQKAAY
710 720 730 740 750
LLGCSLEELS SAIFKHQHKG GTLQRSTSFR QGPEESGLGD GTGPKLSALE
760 770 780 790 800
CLEGMAAGLY SELFTLLVSL VNRALKSSQH SLCSMMIVDT PGFQNPEQGG
810 820 830 840 850
SARGASFEEL CHNYTQDRLQ RLFHERTFVQ ELERYKEENI ELAFDDLEPP
860 870 880 890 900
TDDSVAAVDQ ASHQSLVRSL ARTDEARGLL WLLEEEALVP GASEDTLLER
910 920 930 940 950
LFSYYGPQEG DKKGQSPLLH SSKPHHFLLG HSHGTNWVEY NVTGWLNYTK
960 970 980 990 1000
QNPATQNAPR LLQDSQKKII SNLFLGRAGS ATVLSGSIAG LEGGSQLALR
1010 1020 1030 1040 1050
RATSMRKTFT TGMAAVKKKS LCIQMKLQVD ALIDTIKKSK LHFVHCFLPV
1060 1070 1080 1090 1100
AEGWAGEPRS ASSRRVSSSS ELDLPSGDHC EAGLLQLDVP LLRTQLRGSR
1110 1120 1130 1140 1150
LLDAMRMYRQ GYPDHMVFSE FRRRFDVLAP HLTKKHGRNY IVVDERRAVE
1160 1170 1180 1190 1200
ELLECLDLEK SSCCMGLSRV FFRAGTLARL EEQRDEQTSR NLTLFQAACR
1210 1220 1230 1240 1250
GYLARQHFKK RKIQDLAIRC VQKNIKKNKG VKDWPWWKLF TTVRPLIEVQ
1260 1270 1280 1290 1300
LSEEQIRNKD EEIQQLRSKL EKAEKERNEL RLNSDRLESR ISELTSELTD
1310 1320 1330 1340 1350
ERNTGESASQ LLDAETAERL RAEKEMKELQ TQYDALKKQM EVMEMEVMEA
1360 1370 1380 1390 1400
RLIRAAEING EVDDDDAGGE WRLKYERAVR EVDFTKKRLQ QEFEDKLEVE
1410 1420 1430 1440 1450
QQNKRQLERR LGDLQADSEE SQRALQQLKK KCQRLTAELQ DTKLHLEGQQ
1460 1470 1480 1490 1500
VRNHELEKKQ RRFDSELSQA HEEAQREKLQ REKLQREKDM LLAEAFSLKQ
1510 1520 1530 1540 1550
QLEEKDMDIA GFTQKVVSLE AELQDISSQE SKDEASLAKV KKQLRDLEAK
1560 1570 1580 1590 1600
VKDQEEELDE QAGTIQMLEQ LKQMEVQLEE EYEDKQKVLR EKRELEGKLA
1610 1620 1630 1640 1650
TLSDQVNRRD FESEKRLRKD LKRTKALLAD AQLMLDHLKN SAPSKREIAQ
1660 1670 1680 1690 1700
LKNQLEESEF TCAAAVKARK AMEVEIEDLH LQIDDIAKAK TALEEQLSRL
1710 1720 1730 1740 1750
QREKNEIQNR LEEDQEDMNE LMKKHKAAVA QASRDLAQIN DLQAQLEEAN
1760 1770 1780 1790 1800
KEKQELQEKL QALQSQVEFL EQSMVDKSLV SRQEAKIREL ETRLEFERTQ
1810 1820 1830 1840 1850
VKRLESLASR LKENMEKLTE ERDQRIAAEN REKEQNKRLQ RQLRDTKEEM
1860 1870 1880 1890 1900
GELARKEAEA SRKKHELEMD LESLEAANQS LQADLKLAFK RIGDLQAAIE
1910 1920 1930 1940 1950
DEMESDENED LINSEGDSDV DSELEDRVDG VKSWLSKNKG PSKAASDDGS
1960 1970 1980 1990 2000
LKSSSPTSYW KSLAPDRSDD EHDPLDNTSR PRYSHSYLSD SDTEAKLTET

NA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again