Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q94AH1 Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 2 n=24 Tax=Brassicaceae TaxID=3700 RepID=CAND2_ARATH MRVLSEIAESPFVISRLSPDSTATGGFIGGWVGKCHGFLHNTVLVLASILFVAYLAYEAK KSLSKLSNRRSYIMIAYYGFLWLVSLLNLAWCCLQAWECTPGKEVIWNLLTLFTTSGMLF LEVSLVAFLFQGNYASGAEALTRTFLISGLVIGLDLLLKAIYLFGFGVPLFIDNNEHIHK FKWGLWVIHKLLLAGIYGMIFFMYNSKWRERLPARPAFYKYITVMLALNGLSLFACALTA NGAHFGLWLYGITSVCYHAFYLPLLYVTFLADFFQEEDLNLENVYYSEMKDAGFFDADWE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q94AH1CAND2_ARATHProtein CANDIDATE G-PROTEIN COUPLED RECEPTOR 2Arabidopsis thaliana (Mouse-ear cress)3702UniRef100_Q94AH1
300Representative
A0A1J3FBM0A0A1J3FBM0_NOCCATransmembrane protein adipocyte-associated 1 (Fragment)Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3FBM0
368Seed
A0A1J3I514A0A1J3I514_NOCCATransmembrane protein adipocyte-associated 1 (Fragment)Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3FBM0
363
A0A1J3CJ87A0A1J3CJ87_NOCCATransmembrane protein adipocyte-associated 1 (Fragment)Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3CJ87
360
D7L319D7L319_ARALLPredicted proteinArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)81972UniRef100_D7L319
311
R0HN02R0HN02_9BRASUncharacterized proteinCapsella rubella81985UniRef100_R0HN02
306
A0A1J3JN16A0A1J3JN16_NOCCATransmembrane protein adipocyte-associated 1Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3JN16
306
V4MAX1V4MAX1_EUTSAUncharacterized proteinEutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum)72664UniRef100_V4MAX1
306
A0A565B4J4A0A565B4J4_9BRASUncharacterized proteinArabis nemorensis586526UniRef100_A0A565B4J4
306
A0A0D3B9R2A0A0D3B9R2_BRAOLUncharacterized proteinBrassica oleracea var. oleracea109376UniRef100_A0A0D3B9R2
301
M4CAA4M4CAA4_BRARPUncharacterized proteinBrassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)51351UniRef100_M4CAA4
301
A0A3N6QMV0A0A3N6QMV0_BRACRUncharacterized proteinBrassica cretica (Mustard)69181UniRef100_A0A3N6QMV0
301
A0A078HVA0A0A078HVA0_BRANABnaC03g34090D proteinBrassica napus (Rape)3708UniRef100_A0A078HVA0
301
A0A397ZZY0A0A397ZZY0_BRACMUncharacterized proteinBrassica campestris (Field mustard)3711UniRef100_A0A397ZZY0
301
A0A087H705A0A087H705_ARAALUncharacterized proteinArabis alpina (Alpine rock-cress)50452UniRef100_A0A087H705
300
A0A178V840A0A178V840_ARATHCand2Arabidopsis thaliana (Mouse-ear cress)3702UniRef100_A0A178V840
300
UPI00085A1837transmembrane protein adipocyte-associated 1-likeRaphanus sativus (Radish) (Raphanus raphanistrum var. sativus)3726UniRef100_UPI00085A1837
301
UPI0006AB0C90transmembrane protein adipocyte-associated 1-likeBrassica napus (Rape)3708UniRef100_UPI0006AB0C90
301
UPI00085A9182transmembrane protein adipocyte-associated 1-likeRaphanus sativus (Radish) (Raphanus raphanistrum var. sativus)3726UniRef100_UPI00085A9182
301
UPI0006AB358Ctransmembrane protein adipocyte-associated 1-likeBrassica napus (Rape)3708UniRef100_UPI0006AB358C
301
UPI000A29D425transmembrane protein adipocyte-associated 1Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)81972UniRef100_UPI000A29D425
300
UPI000539C474transmembrane protein adipocyte-associated 1-likeCamelina sativa (False flax) (Myagrum sativum)90675UniRef100_UPI000539C474
300
UPI000539CCCFtransmembrane protein adipocyte-associated 1 isoform X1Camelina sativa (False flax) (Myagrum sativum)90675UniRef100_UPI000539CCCF
300
UPI00053B524Dtransmembrane protein adipocyte-associated 1Camelina sativa (False flax) (Myagrum sativum)90675UniRef100_UPI00053B524D
300

Sequence

Representative sequenceiLengthMass (Da)Tools
Q94AH1

Checksumi: 4975BA386A438569

FASTA30034,063
        10         20         30         40         50
MRVLSEIAES PFVISRLSPD STATGGFIGG WVGKCHGFLH NTVLVLASIL
60 70 80 90 100
FVAYLAYEAK KSLSKLSNRR SYIMIAYYGF LWLVSLLNLA WCCLQAWECT
110 120 130 140 150
PGKEVIWNLL TLFTTSGMLF LEVSLVAFLF QGNYASGAEA LTRTFLISGL
160 170 180 190 200
VIGLDLLLKA IYLFGFGVPL FIDNNEHIHK FKWGLWVIHK LLLAGIYGMI
210 220 230 240 250
FFMYNSKWRE RLPARPAFYK YITVMLALNG LSLFACALTA NGAHFGLWLY
260 270 280 290 300
GITSVCYHAF YLPLLYVTFL ADFFQEEDLN LENVYYSEMK DAGFFDADWE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again