Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96B97-3 Isoform 3 of SH3 domain-containing kinase-binding protein 1 n=63 Tax=Boreoeutheria TaxID=1437010 RepID=Isoform 3 of SH3K1_HUMAN MGEETIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLIN KDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERK HEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALP PRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSH PTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVT ISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPK MEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDI KKALQSK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 63  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96B97-3Isoform 3 of SH3K1_HUMAN3Homo sapiens (Human)9606UniRef100_Q96B97-3
427Representative
A0A2R8MIK9A0A2R8MIK9_CALJASH3 domain containing kinase binding protein 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MIK9
431
A0A2K5ENU8A0A2K5ENU8_AOTNASH3 domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2R8MIK9
431
F7B4T8F7B4T8_MACMUSH3 domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7B4T8
430
A0A337SB91A0A337SB91_FELCASH3 domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A337SB91
428
A0A2K5HN40A0A2K5HN40_COLAPSH3 domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HN40
427
A0A2K6PVH1A0A2K6PVH1_RHIROSH3 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVH1
427
A0A2R9BN11A0A2R9BN11_PANPASH3 domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BN11
427
A0A2K5HN48A0A2K5HN48_COLAPSH3 domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HN48
427
A0A2K5QB84A0A2K5QB84_CEBCASH3 domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5QB84
427
A0A2K6CWW1A0A2K6CWW1_MACNESH3 domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CWW1
427
H9ES16H9ES16_MACMUSH3 domain-containing kinase-binding protein 1 isoform cMacaca mulatta (Rhesus macaque)9544UniRef100_H9ES16
427
A0A2J8W451A0A2J8W451_PONABSH3KBP1 isoform 8Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8W451
427
A0A2K6V8J0A0A2K6V8J0_SAIBBSH3 domain-containing proteinSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6V8J0
427
A0A2K5ZKY1A0A2K5ZKY1_MANLESH3 domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZKY1
427
A0A2K6CWT7A0A2K6CWT7_MACNESH3 domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CWT7
427
A0A2K5ZKW8A0A2K5ZKW8_MANLESH3 domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZKW8
427
A0A1D5QCI5A0A1D5QCI5_MACMUSH3 domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QCI5
427
A0A2I3M1K7A0A2I3M1K7_PAPANSH3 domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A1D5QCI5
427
A0A2K5W6X5A0A2K5W6X5_MACFASH3 domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A1D5QCI5
427
A0A4W2IK55A0A4W2IK55_BOBOXSH3 domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2IK55
427
A0A2I3MQK4A0A2I3MQK4_PAPANSH3 domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MQK4
427
A0A2K5W701A0A2K5W701_MACFASH3 domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2I3MQK4
427
K7DU14K7DU14_PANTRSH3 domain containing kinase binding protein 1Pan troglodytes (Chimpanzee)9598UniRef100_K7DU14
427
A0A2K6PVG8A0A2K6PVG8_RHIROSH3 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVG8
427

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96B97-3

Checksumi: CDD6AC2770E695F4

FASTA42746,610
        10         20         30         40         50
MGEETIGKKL PATTATPDSS KTEMDSRTKS KDYCKVIFPY EAQNDDELTI
60 70 80 90 100
KEGDIVTLIN KDCIDVGWWE GELNGRRGVF PDNFVKLLPP DFEKEGNRPK
110 120 130 140 150
KPPPPSAPVI KQGAGTTERK HEIKKIPPER PEMLPNRTEE KERPEREPKL
160 170 180 190 200
DLQKPSVPAI PPKKPRPPKT NSLSRPGALP PRRPERPVGP LTHTRGDSPK
210 220 230 240 250
IDLAGSSLSG ILDKDLSDRS NDIDLEGFDS VVSSTEKLSH PTTSRPKATG
260 270 280 290 300
RRPPSQSLTS SSLSSPDIFD SPSPEEDKEE HISLAHRGVD ASKKTSKTVT
310 320 330 340 350
ISQVSDNKAS LPPKPGTMAA GGGGPAPLSS AAPSPLSSSL GTAGHRANSP
360 370 380 390 400
SLFGTEGKPK MEPAASSQAA VEELRTQVRE LRSIIETMKD QQKREIKQLL
410 420
SELDEEKKIR LRLQMEVNDI KKALQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again