Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96B97-3 Isoform 3 of SH3 domain-containing kinase-binding protein 1 n=43 Tax=Simiiformes TaxID=314293 RepID=Isoform 3 of SH3K1_HUMAN MGEETIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLIN KDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERK HEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALP PRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSH PTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVT ISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPK MEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDI KKALQSK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 43  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K6L4K1A0A2K6L4K1_RHIBESH3 domain containing kinase binding protein 1Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6L4K1
372
A0A2I3HCS1A0A2I3HCS1_NOMLESH3 domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3HCS1
391
A0A2I3G1M4A0A2I3G1M4_NOMLESH3 domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3G1M4
406
UPI0005F3B25BSH3 domain-containing kinase-binding protein 1 isoform X12Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F3B25B
426
UPI0005F55E77SH3 domain-containing kinase-binding protein 1 isoform X13Macaca nemestrina (Pig-tailed macaque)9545UniRef100_UPI0005F55E77
426
UPI0003ABB73ESH3 domain-containing kinase-binding protein 1 isoform X14Macaca mulatta (Rhesus macaque)9544UniRef100_UPI0003ABB73E
426
Q96B97-3Isoform 3 of SH3K1_HUMAN3Homo sapiens (Human)9606UniRef100_Q96B97-3
427Representative
A0A2K6CWW1A0A2K6CWW1_MACNESH3 domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CWW1
427
U3C6Q4U3C6Q4_CALJASH3 domain containing kinase binding protein 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3C6Q4
427
A0A2K5QB84A0A2K5QB84_CEBCASH3 domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5QB84
427
A0A2I3MQK4A0A2I3MQK4_PAPANSH3 domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MQK4
427
A0A2K5W701A0A2K5W701_MACFASH3 domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2I3MQK4
427
A0A2K5HN48A0A2K5HN48_COLAPSH3 domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HN48
427
A0A2K6PVH1A0A2K6PVH1_RHIROSH3 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVH1
427
A0A2K6PVG8A0A2K6PVG8_RHIROSH3 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVG8
427
A0A2K5HN40A0A2K5HN40_COLAPSH3 domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HN40
427
K7DU14K7DU14_PANTRSH3 domain containing kinase binding protein 1Pan troglodytes (Chimpanzee)9598UniRef100_K7DU14
427
A0A2R9BJE3A0A2R9BJE3_PANPASH3 domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BJE3
427
A0A2K5M7J9A0A2K5M7J9_CERATSH3 domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M7J9
427
A0A2K6CWT7A0A2K6CWT7_MACNESH3 domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CWT7
427
A0A1D5QCI5A0A1D5QCI5_MACMUSH3 domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QCI5
427
A0A2I3M1K7A0A2I3M1K7_PAPANSH3 domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A1D5QCI5
427
A0A2K5W6X5A0A2K5W6X5_MACFASH3 domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A1D5QCI5
427
A0A2R9BN11A0A2R9BN11_PANPASH3 domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BN11
427
A0A2I2Z2C7A0A2I2Z2C7_GORGOSH3 domain containing kinase binding protein 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z2C7
427

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96B97-3

Checksumi: CDD6AC2770E695F4

FASTA42746,610
        10         20         30         40         50
MGEETIGKKL PATTATPDSS KTEMDSRTKS KDYCKVIFPY EAQNDDELTI
60 70 80 90 100
KEGDIVTLIN KDCIDVGWWE GELNGRRGVF PDNFVKLLPP DFEKEGNRPK
110 120 130 140 150
KPPPPSAPVI KQGAGTTERK HEIKKIPPER PEMLPNRTEE KERPEREPKL
160 170 180 190 200
DLQKPSVPAI PPKKPRPPKT NSLSRPGALP PRRPERPVGP LTHTRGDSPK
210 220 230 240 250
IDLAGSSLSG ILDKDLSDRS NDIDLEGFDS VVSSTEKLSH PTTSRPKATG
260 270 280 290 300
RRPPSQSLTS SSLSSPDIFD SPSPEEDKEE HISLAHRGVD ASKKTSKTVT
310 320 330 340 350
ISQVSDNKAS LPPKPGTMAA GGGGPAPLSS AAPSPLSSSL GTAGHRANSP
360 370 380 390 400
SLFGTEGKPK MEPAASSQAA VEELRTQVRE LRSIIETMKD QQKREIKQLL
410 420
SELDEEKKIR LRLQMEVNDI KKALQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again