Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96EE3-1 Isoform B of Nucleoporin SEH1 n=3 Tax=Catarrhini TaxID=9526 RepID=Isoform 1 of SEH1_HUMAN MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRYFF TPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEG I

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96EE3-1Isoform 1 of SEH1_HUMANB, SEH1BHomo sapiens (Human)9606UniRef100_Q96EE3-1
421Representative & Seed
A0A2K5I3B4A0A2K5I3B4_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5I3B4
337
UPI0005CFFB11nucleoporin SEH1 isoform X7Homo sapiens (Human)9606UniRef100_Q96EE3-1
296

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96EE3-1

Checksumi: 0662C6681BB6CE68

FASTA42146,578
        10         20         30         40         50
MFVARSIAAD HKDLIHDVSF DFHGRRMATC SSDQSVKVWD KSESGDWHCT
60 70 80 90 100
ASWKTHSGSV WRVTWAHPEF GQVLASCSFD RTAAVWEEIV GESNDKLRGQ
110 120 130 140 150
SHWVKRTTLV DSRTSVTDVK FAPKHMGLML ATCSADGIVR IYEAPDVMNL
160 170 180 190 200
SQWSLQHEIS CKLSCSCISW NPSSSRAHSP MIAVGSDDSS PNAMAKVQIF
210 220 230 240 250
EYNENTRKYA KAETLMTVTD PVHDIAFAPN LGRSFHILAI ATKDVRIFTL
260 270 280 290 300
KPVRKELTSS GGPTKFEIHI VAQFDNHNSQ VWRVSWNITG TVLASSGDDG
310 320 330 340 350
CVRLWKANYM DNWKCTGILK GNGSPVNGSS QQGTSNPSLG STIPSLQNSL
360 370 380 390 400
NGSSAGRYFF TPLDSPRAGS RWSSYAQLLP PPPPPLVEHS CDADTANLQY
410 420
PHPRRRYLSR PLNPLPENEG I
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again