Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96KN2 Beta-Ala-His dipeptidase n=31 Tax=Catarrhini TaxID=9526 RepID=CNDP1_HUMAN MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIE SDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGS DPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAF RALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAIT YGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVV PLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPG TKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIA NIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQ NEKINRWNYIEGTKLFAAFFLEMAQLH

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 31  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96KN2CNDP1_HUMANBeta-Ala-His dipeptidaseHomo sapiens (Human)9606UniRef100_Q96KN2
507Representative
A0A2I3RCE2A0A2I3RCE2_PANTRCarnosine dipeptidase 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RCE2
527
H2QEQ1H2QEQ1_PANTRCNDP1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2QEQ1
508
A0A2R9AT56A0A2R9AT56_PANPAM20_dimer domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9AT56
508
A8K1K1A8K1K1_HUMANcDNA FLJ76342, highly similar to Homo sapiens carnosine dipeptidase 1 (metallopeptidase M20 family)(CNDP1), mRNAHomo sapiens (Human)9606UniRef100_A8K1K1
507
A0A2I2Z7W3A0A2I2Z7W3_GORGOCarnosine dipeptidase 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z7W3
507
A0A1D5QGM5A0A1D5QGM5_MACMUM20_dimer domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QGM5
499
B4E180B4E180_HUMANcDNA FLJ61201, highly similar to Beta-Ala-His dipeptidaseHomo sapiens (Human)9606UniRef100_B4E180
493
A0A2K6LLD9A0A2K6LLD9_RHIBEM20_dimer domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LLD9
464
A0A2K6PTJ6A0A2K6PTJ6_RHIROM20_dimer domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6LLD9
457
A0A2K6PTJ1A0A2K6PTJ1_RHIROM20_dimer domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PTJ1
464
A0A2K5M9B4A0A2K5M9B4_CERATM20_dimer domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M9B4
464
A0A2J8T7T0A0A2J8T7T0_PONABCNDP1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8T7T0
464
A0A2K6DKM9A0A2K6DKM9_MACNEM20_dimer domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DKM9
464
G3S5S4G3S5S4_GORGOCarnosine dipeptidase 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S5S4
464
A0A2I3RWC1A0A2I3RWC1_PANTRCNDP1 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RWC1
464
Q5RA69Q5RA69_PONABUncharacterized protein DKFZp459C1929Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RA69
464
A0A2K5XAN4A0A2K5XAN4_MANLEM20_dimer domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XAN4
464
A0A1D5RKK1A0A1D5RKK1_MACMUM20_dimer domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RKK1
464
J3KRP0J3KRP0_HUMANBeta-Ala-His dipeptidaseHomo sapiens (Human)9606UniRef100_J3KRP0
464
UPI000512190Abeta-Ala-His dipeptidase isoform X1Pan troglodytes (Chimpanzee)9598UniRef100_UPI000512190A
577Seed
UPI0005123C5Bbeta-Ala-His dipeptidase isoform X2Pan troglodytes (Chimpanzee)9598UniRef100_UPI0005123C5B
574
UPI0004F0A150beta-Ala-His dipeptidase isoform X1Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI0004F0A150
574
UPI000511D8F1beta-Ala-His dipeptidase isoform X3Pan troglodytes (Chimpanzee)9598UniRef100_UPI000511D8F1
533
UPI0006C9A0D4beta-Ala-His dipeptidase isoform X2Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI0006C9A0D4
530

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96KN2

Checksumi: 756CCD872996F192

FASTA50756,706
        10         20         30         40         50
MDPKLGRMAA SLLAVLLLLL ERGMFSSPSP PPALLEKVFQ YIDLHQDEFV
60 70 80 90 100
QTLKEWVAIE SDSVQPVPRF RQELFRMMAV AADTLQRLGA RVASVDMGPQ
110 120 130 140 150
QLPDGQSLPI PPIILAELGS DPTKGTVCFY GHLDVQPADR GDGWLTDPYV
160 170 180 190 200
LTEVDGKLYG RGATDNKGPV LAWINAVSAF RALEQDLPVN IKFIIEGMEE
210 220 230 240 250
AGSVALEELV EKEKDRFFSG VDYIVISDNL WISQRKPAIT YGTRGNSYFM
260 270 280 290 300
VEVKCRDQDF HSGTFGGILH EPMADLVALL GSLVDSSGHI LVPGIYDEVV
310 320 330 340 350
PLTEEEINTY KAIHLDLEEY RNSSRVEKFL FDTKEEILMH LWRYPSLSIH
360 370 380 390 400
GIEGAFDEPG TKTVIPGRVI GKFSIRLVPH MNVSAVEKQV TRHLEDVFSK
410 420 430 440 450
RNSSNKMVVS MTLGLHPWIA NIDDTQYLAA KRAIRTVFGT EPDMIRDGST
460 470 480 490 500
IPIAKMFQEI VHKSVVLIPL GAVDDGEHSQ NEKINRWNYI EGTKLFAAFF

LEMAQLH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again