Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96Q83 Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 n=62 Tax=Eutheria TaxID=9347 RepID=ALKB3_HUMAN MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQ QVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTG IREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNL YRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD HGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
UPI000006E69Balpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Pan troglodytes (Chimpanzee)9598UniRef100_Q96Q83
139
UPI00062676FFalpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Aotus nancymaae (Ma's night monkey)37293UniRef100_UPI00062676FF
322
UPI00062685B5alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X1Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5EH47
323Seed
UPI000533E3A2alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_UPI000533E3A2
288
UPI000C2987F6alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X1Piliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000C2987F6
286
UPI00006D139Dalpha-ketoglutarate-dependent dioxygenase alkB homolog 3Macaca mulatta (Rhesus macaque)9544UniRef100_UPI00006D139D
286
UPI00020AA406alpha-ketoglutarate-dependent dioxygenase alkB homolog 3Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3FW85
302
UPI000C81274Calpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Loxodonta africana (African elephant)9785UniRef100_UPI000C81274C
285
UPI0007329BA1alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Macaca mulatta (Rhesus macaque)9544UniRef100_UPI0007329BA1
285
UPI000C2967DFalpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Piliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000C2967DF
285
UPI000643BE00alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X1Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI000643BE00
285
UPI0004EFFCA7alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI0004EFFCA7
284
UPI00080A35A8alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Cebus capucinus imitator1737458UniRef100_UPI00080A35A8
284
UPI00064289DAalpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI00064289DA
284
UPI0004F02E17alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI0004F02E17
283
UPI000809E420alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Cebus capucinus imitator1737458UniRef100_UPI000809E420
282
UPI00045D9B81alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045D9B81
282
UPI0001D3FA0Falpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI0001D3FA0F
281
UPI000809A35Calpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X4Cebus capucinus imitator1737458UniRef100_UPI000809A35C
281
UPI00083FB8C7alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X4Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI00083FB8C7
280
UPI000533564Balpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_UPI000533564B
272
UPI00075FF153alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI00075FF153
272
UPI0005F4AF18alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X4Macaca nemestrina (Pig-tailed macaque)9545UniRef100_UPI0005F4AF18
272
UPI0010A27750alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Macaca mulatta (Rhesus macaque)9544UniRef100_UPI0010A27750
272
UPI00064290E8alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI00064290E8
260

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96Q83

Checksumi: F6563635B1F217D7

FASTA28633,375
        10         20         30         40         50
MEEKRRRARV QGAWAAPVKS QAIAQPATTA KSHLHQKPGQ TWKNKEHHLS
60 70 80 90 100
DREFVFKEPQ QVVRRAPEPR VIDREGVYEI SLSPTGVSRV CLYPGFVDVK
110 120 130 140 150
EADWILEQLC QDVPWKQRTG IREDITYQQP RLTAWYGELP YTYSRITMEP
160 170 180 190 200
NPHWHPVLRT LKNRIEENTG HTFNSLLCNL YRNEKDSVDW HSDDEPSLGR
210 220 230 240 250
CPIIASLSFG ATRTFEMRKK PPPEENGDYT YVERVKIPLD HGTLLIMEGA
260 270 280
TQADWQHRVP KEYHSREPRV NLTFRTVYPD PRGAPW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again