Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q96Q83 Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 n=62 Tax=Eutheria TaxID=9347 RepID=ALKB3_HUMAN MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQ QVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTG IREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNL YRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD HGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 37  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96Q83ALKB3_HUMANAlpha-ketoglutarate-dependent dioxygenase alkB homolog 3Homo sapiens (Human)9606UniRef100_Q96Q83
286Representative
H2Q3G1H2Q3G1_PANTRALKBH3 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_Q96Q83
286
A0A2R9A6R0A0A2R9A6R0_PANPAFe2OG dioxygenase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q96Q83
286
E9PRD0E9PRD0_HUMANAlpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (Fragment)Homo sapiens (Human)9606UniRef100_Q96Q83
60
A0A2J8LHR5A0A2J8LHR5_PANTRALKBH3 isoform 11 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_Q96Q83
60
A0A2J8WFM8A0A2J8WFM8_PONABALKBH3 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFM8
295
A0A2J8WFN3A0A2J8WFN3_PONABALKBH3 isoform 11 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFM8
60
A0A2K5EH47A0A2K5EH47_AOTNAFe2OG dioxygenase domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5EH47
289
A0A2K6T3X9A0A2K6T3X9_SAIBBAlkB homolog 3, alpha-ketoglutaratedependent dioxygenaseSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6T3X9
289
G3QHR7G3QHR7_GORGOAlkB homolog 3, alpha-ketoglutaratedependent dioxygenaseGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QHR7
286
A0A2K6DSE6A0A2K6DSE6_MACNEFe2OG dioxygenase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DSE6
286
A0A2K5UVC8A0A2K5UVC8_MACFAFe2OG dioxygenase domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UVC8
286
A0A2K5HMC7A0A2K5HMC7_COLAPFe2OG dioxygenase domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HMC7
286
A0A2I3FW85A0A2I3FW85_NOMLEFe2OG dioxygenase domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3FW85
286
H9EVC6H9EVC6_MACMUAlpha-ketoglutarate-dependent dioxygenase alkB homolog 3Macaca mulatta (Rhesus macaque)9544UniRef100_H9EVC6
286
A0A2K6R917A0A2K6R917_RHIROFe2OG dioxygenase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6R917
286
A0A2K6L9Z2A0A2K6L9Z2_RHIBEFe2OG dioxygenase domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6L9Z2
286
G3SSE3G3SSE3_LOXAFFe2OG dioxygenase domain-containing proteinLoxodonta africana (African elephant)9785UniRef100_G3SSE3
286
A0A2K5MGB2A0A2K5MGB2_CERATFe2OG dioxygenase domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5MGB2
286
G7NDJ3G7NDJ3_MACMUAlpha-ketoglutarate-dependent dioxygenase alkB-like protein 3Macaca mulatta (Rhesus macaque)9544UniRef100_G7NDJ3
286
G7PQD2G7PQD2_MACFAAlpha-ketoglutarate-dependent dioxygenase alkB-like protein 3Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PQD2
286
A0A2Y9RGA1A0A2Y9RGA1_TRIMAalpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9RGA1
286
A0A2K5ZK81A0A2K5ZK81_MANLEFe2OG dioxygenase domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZK81
286
A0A2K6DSF0A0A2K6DSF0_MACNEFe2OG dioxygenase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DSF0
285
A0A2K5MGB9A0A2K5MGB9_CERATFe2OG dioxygenase domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5MGB9
285

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96Q83

Checksumi: F6563635B1F217D7

FASTA28633,375
        10         20         30         40         50
MEEKRRRARV QGAWAAPVKS QAIAQPATTA KSHLHQKPGQ TWKNKEHHLS
60 70 80 90 100
DREFVFKEPQ QVVRRAPEPR VIDREGVYEI SLSPTGVSRV CLYPGFVDVK
110 120 130 140 150
EADWILEQLC QDVPWKQRTG IREDITYQQP RLTAWYGELP YTYSRITMEP
160 170 180 190 200
NPHWHPVLRT LKNRIEENTG HTFNSLLCNL YRNEKDSVDW HSDDEPSLGR
210 220 230 240 250
CPIIASLSFG ATRTFEMRKK PPPEENGDYT YVERVKIPLD HGTLLIMEGA
260 270 280
TQADWQHRVP KEYHSREPRV NLTFRTVYPD PRGAPW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again