Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q99836-5 Isoform 5 of Myeloid differentiation primary response protein MyD88 n=12 Tax=Boreoeutheria TaxID=1437010 RepID=Isoform 5 of MYD88_HUMAN MAAGGPGAGSAAPISSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE IRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q99836-5Isoform 5 of MYD88_HUMAN5Homo sapiens (Human)9606UniRef100_Q99836-5
275Representative
B3Y679MYD88_PANPAMyeloid differentiation primary response protein MyD88Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_B3Y679
296
G1SHI2G1SHI2_RABITMyeloid differentiation primary response protein MyD88Oryctolagus cuniculus (Rabbit)9986UniRef100_G1SHI2
305
F6TAV5F6TAV5_HORSEMyeloid differentiation primary response protein MyD88Equus caballus (Horse)9796UniRef100_F6TAV5
296
Q4JIK2Q4JIK2_HORSEMyeloid differentiation primary response 88 (Fragment)Equus caballus (Horse)9796UniRef100_F6TAV5
73
A0A1U7U2R8A0A1U7U2R8_TARSYMyeloid differentiation primary response protein MyD88Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7U2R8
296
UPI0001CE18E5myeloid differentiation primary response protein MyD88 isoform X1Oryctolagus cuniculus (Rabbit)9986UniRef100_UPI0001CE18E5
343Seed
UPI0004D04E9Emyeloid differentiation primary response protein MyD88Galeopterus variegatus (Malayan flying lemur) (Cynocephalus variegatus)482537UniRef100_UPI0004D04E9E
296
UPI00071A1020myeloid differentiation primary response protein MyD88Equus asinus (Donkey) (Equus africanus asinus)9793UniRef100_UPI00071A1020
296
UPI00032ADD57myeloid differentiation primary response protein MyD88Ochotona princeps (Southern American pika)9978UniRef100_UPI00032ADD57
296
UPI0004BD6386myeloid differentiation primary response protein MyD88 isoform X1Equus przewalskii (Przewalski's horse) (Equus caballus przewalskii)9798UniRef100_UPI0004BD6386
296
UPI00081368C3myeloid differentiation primary response protein MyD88 isoform X1Manis javanica (Malayan pangolin) (Sunda pangolin)9974UniRef100_UPI00081368C3
294

Sequence

Representative sequenceiLengthMass (Da)Tools
Q99836-5

Checksumi: 5FAAE7CF231BE985

FASTA29633,256
        10         20         30         40         50
MAAGGPGAGS AAPISSTSSL PLAALNMRVR RRLSLFLNVR TQVAADWTAL
60 70 80 90 100
AEEMDFEYLE IRQLETHADP TGRLLDAWQG RPGASVGRLL ELLTKLGRDD
110 120 130 140 150
VLLELGPSIE EDCQKYILKQ QQEEAEKPLQ VAAVDSSVPR TAELAGITTL
160 170 180 190 200
DDPLGHMPER FDAFICYCPS DIQFVQEMIR QLEQTNYRLK LCVSDRDVLP
210 220 230 240 250
GTCVWSIASE LIEKRCRRMV VVVSDDYLQS KECDFQTKFA LSLSPGAHQK
260 270 280 290
RLIPIKYKAM KKEFPSILRF ITVCDYTNPC TKSWFWTRLA KALSLP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again