Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9BSL1 Ubiquitin-associated domain-containing protein 1 n=9 Tax=Eutheria TaxID=9347 RepID=UBAC1_HUMAN MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITH HKLIHAASERVLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPD KEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA NAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTP LPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEM GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGL TNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9BSL1UBAC1_HUMANUbiquitin-associated domain-containing protein 1Homo sapiens (Human)9606UniRef100_Q9BSL1
405Representative
A0A140VK64A0A140VK64_HUMANTesticular secretory protein Li 64Homo sapiens (Human)9606UniRef100_Q9BSL1
405
A0A2Y9RUX6A0A2Y9RUX6_TRIMAubiquitin-associated domain-containing protein 1 isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9RUX6
441Seed
G3TGL0G3TGL0_LOXAFUncharacterized proteinLoxodonta africana (African elephant)9785UniRef100_G3TGL0
405
A0A024R8I2A0A024R8I2_HUMANUbiquitin associated domain containing 1, isoform CRA_cHomo sapiens (Human)9606UniRef100_A0A024R8I2
404
A0A2Y9E7I0A0A2Y9E7I0_TRIMAubiquitin-associated domain-containing protein 1 isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9E7I0
403
UPI000642A1B5ubiquitin-associated domain-containing protein 1Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI000642A1B5
405
UPI000E5603D8ubiquitin-associated domain-containing protein 1 isoform X1Urocitellus parryii (Arctic ground squirrel) (Spermophilus parryii)9999UniRef100_UPI000E5603D8
405
UPI000E56025Bubiquitin-associated domain-containing protein 1 isoform X2Urocitellus parryii (Arctic ground squirrel) (Spermophilus parryii)9999UniRef100_UPI000E56025B
378

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9BSL1

Checksumi: 5FC8EC84A8602CBE

FASTA40545,338
        10         20         30         40         50
MFVQEEKIFA GKVLRLHICA SDGAEWLEEA TEDTSVEKLK ERCLKHCAHG
60 70 80 90 100
SLEDPKSITH HKLIHAASER VLSDARTILE ENIQDQDVLL LIKKRAPSPL
110 120 130 140 150
PKMADVSAEE KKKQDQKAPD KEAILRATAN LPSYNMDRAA VQTNMRDFQT
160 170 180 190 200
ELRKILVSLI EVAQKLLALN PDAVELFKKA NAMLDEDEDE RVDEAALRQL
210 220 230 240 250
TEMGFPENRA TKALQLNHMS VPQAMEWLIE HAEDPTIDTP LPGQAPPEAE
260 270 280 290 300
GATAAASEAA AGASATDEEA RDELTEIFKK IRRKREFRAD ARAVISLMEM
310 320 330 340 350
GFDEKEVIDA LRVNNNQQNA ACEWLLGDRK PSPEELDKGI DPDSPLFQAI
360 370 380 390 400
LDNPVVQLGL TNPKTLLAFE DMLENPLNST QWMNDPETGP VMLQISRIFQ

TLNRT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again