Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9H5J8 TATA box-binding protein-associated factor RNA polymerase I subunit D n=27 Tax=Catarrhini TaxID=9526 RepID=TAF1D_HUMAN MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVH ASDSSSDSSFEPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLI DKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQM NVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSE FPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9H5J8TAF1D_HUMANTATA box-binding protein-associated factor RNA polymerase I subunit DHomo sapiens (Human)9606UniRef100_Q9H5J8
278Representative
Q5RCX3TAF1D_PONABTATA box-binding protein-associated factor RNA polymerase I subunit DPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RCX3
278
A0A024R3A9A0A024R3A9_HUMANJosephin domain containing 3, isoform CRA_aHomo sapiens (Human)9606UniRef100_Q9H5J8
278
H0YG36H0YG36_HUMANTATA box-binding protein-associated factor RNA polymerase I subunit D (Fragment)Homo sapiens (Human)9606UniRef100_Q9H5J8
42
A0A2J8L1S7A0A2J8L1S7_PANTRTAF1D isoform 13 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_Q9H5J8
42
G1R621G1R621_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1R621
278
A0A2J8XWH7A0A2J8XWH7_PONABTAF1D isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XWH7
278
A0A2J8XWJ3A0A2J8XWJ3_PONABTAF1D isoform 10 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XWH7
42
F6PTS1F6PTS1_MACMUTATA box-binding protein-associated factor RNA polymerase I subunit DMacaca mulatta (Rhesus macaque)9544UniRef100_F6PTS1
278
A0A2K5X2F2A0A2K5X2F2_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6PTS1
278
A0A2K5NQ17A0A2K5NQ17_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NQ17
278
A0A2K5ZSX6A0A2K5ZSX6_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZSX6
278
A0A2K6DCA3A0A2K6DCA3_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DCA3
278
G3SHA0G3SHA0_GORGOTATA-box binding protein associated factor, RNA polymerase I subunit DGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3SHA0
278
A0A096N9Z7A0A096N9Z7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096N9Z7
278
A0A2K6QB03A0A2K6QB03_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QB03
278
A0A0D9S179A0A0D9S179_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9S179
278
A0A2K5J6U8A0A2K5J6U8_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5J6U8
278
G7PNG7G7PNG7_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PNG7
278
A0A2K6KSS2A0A2K6KSS2_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KSS2
277
H2RAP3H2RAP3_PANTRTAF1D isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2RAP3
277
A0A2R9B2B4A0A2R9B2B4_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B2B4
261
UPI00062ACBA6TATA box-binding protein-associated factor RNA polymerase I subunit DNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1R621
291Seed
UPI00083BF3AELOW QUALITY PROTEIN: TATA box-binding protein-associated factor RNA polymerase I subunit DRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_UPI00083BF3AE
278
UPI000C296A0ETATA box-binding protein-associated factor RNA polymerase I subunit DPiliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000C296A0E
278

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9H5J8

Checksumi: 4BA37C73BB387446

FASTA27832,058
        10         20         30         40         50
MDKSGIDSLD HVTSDAVELA NRSDNSSDSS LFKTQCIPYS PKGEKRNPIR
60 70 80 90 100
KFVRTPESVH ASDSSSDSSF EPIPLTIKAI FERFKNRKKR YKKKKKRRYQ
110 120 130 140 150
PTGRPRGRPE GRRNPIYSLI DKKKQFRSRG SGFPFLESEN EKNAPWRKIL
160 170 180 190 200
TFEQAVARGF FNYIEKLKYE HHLKESLKQM NVGEDLENED FDSRRYKFLD
210 220 230 240 250
DDGSISPIEE STAEDEDATH LEDNECDIKL AGDSFIVSSE FPVRLSVYLE
260 270
EEDITEEAAL SKKRATKAKN TGQRGLKM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again