Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9HCD5 Nuclear receptor coactivator 5 n=146 Tax=Eutheria TaxID=9347 RepID=NCOA5_HUMAN MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 86  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9HCD5NCOA5_HUMANNuclear receptor coactivator 5Homo sapiens (Human)9606UniRef100_Q9HCD5
579Representative
A0A2I3H576A0A2I3H576_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_Q9HCD5
579
G3RCP3G3RCP3_GORGONuclear receptor coactivator 5Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q9HCD5
579
A0A2R9BTF8A0A2R9BTF8_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q9HCD5
567
F6TDW3F6TDW3_HORSENuclear receptor coactivator 5Equus caballus (Horse)9796UniRef100_F6TDW3
671Seed
Q6LBZ8Q6LBZ8_RABITTroponin C messenger (aa 132 to 148) (Fragment)Oryctolagus cuniculus (Rabbit)9986UniRef100_F6TDW3
17
Q6LBZ9Q6LBZ9_RABITTroponin C messenger (aa 73 to 102) (fast muscle) (Fragment)Oryctolagus cuniculus (Rabbit)9986UniRef100_F6TDW3
30
A0A4W2HX85A0A4W2HX85_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2HX85
584
A0A2K5VH25A0A2K5VH25_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5VH25
584
A0A2K6MFR7A0A2K6MFR7_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6MFR7
584
A0A2K5INT0A0A2K5INT0_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K6MFR7
584
A0A2I3LQ59A0A2I3LQ59_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LQ59
584
A0A2K6CIP0A0A2K6CIP0_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2I3LQ59
584
A0A2Y9D971A0A2Y9D971_TRIMAnuclear receptor coactivator 5 isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9D971
582
A0A2Y9RZK8A0A2Y9RZK8_TRIMAnuclear receptor coactivator 5 isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9D971
529
G3TL33G3TL33_LOXAFUncharacterized proteinLoxodonta africana (African elephant)9785UniRef100_G3TL33
582
A0A1U7TI72A0A1U7TI72_TARSYnuclear receptor coactivator 5 isoform X1Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TI72
580
A0A3Q0DXK5A0A3Q0DXK5_TARSYnuclear receptor coactivator 5 isoform X2Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TI72
496
A0A3Q7PCA2A0A3Q7PCA2_CALURnuclear receptor coactivator 5 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PCA2
579
A0A2Y9GZC6A0A2Y9GZC6_NEOSCnuclear receptor coactivator 5 isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A3Q7PCA2
579
A0A2U3WAE8A0A2U3WAE8_ODOROnuclear receptor coactivator 5 isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A3Q7PCA2
579
A0A3Q7PBY5A0A3Q7PBY5_CALURnuclear receptor coactivator 5 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PCA2
526
A0A2U3Y7X7A0A2U3Y7X7_LEPWEnuclear receptor coactivator 5Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A3Q7PCA2
526
A0A2Y9GZC9A0A2Y9GZC9_NEOSCnuclear receptor coactivator 5 isoform X2Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A3Q7PCA2
526
A0A340WX76A0A340WX76_LIPVEnuclear receptor coactivator 5Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WX76
579

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9HCD5

Checksumi: D2ADCCEBEE566A91

FASTA57965,536
        10         20         30         40         50
MNTAPSRPSP TRRDPYGFGD SRDSRRDRSP IRGSPRREPR DGRNGRDARD
60 70 80 90 100
SRDIRDPRDL RDHRHSRDLR DHRDSRSVRD VRDVRDLRDF RDLRDSRDFR
110 120 130 140 150
DQRDPMYDRY RDMRDSRDPM YRREGSYDRY LRMDDYCRRK DDSYFDRYRD
160 170 180 190 200
SFDGRGPPGP ESQSRAKERL KREERRREEL YRQYFEEIQR RFDAERPVDC
210 220 230 240 250
SVIVVNKQTK DYAESVGRKV RDLGMVVDLI FLNTEVSLSQ ALEDVSRGGS
260 270 280 290 300
PFAIVITQQH QIHRSCTVNI MFGTPQEHRN MPQADAMVLV ARNYERYKNE
310 320 330 340 350
CREKEREEIA RQAAKMADEA ILQERERGGP EEGVRGGHPP AIQSLINLLA
360 370 380 390 400
DNRYLTAEET DKIINYLRER KERLMRSSTD SLPGPISRQP LGATSGASLK
410 420 430 440 450
TQPSSQPLQS GQVLPSATPT PSAPPTSQQE LQAKILSLFN SGTVTANSSS
460 470 480 490 500
ASPSVAAGNT PNQNFSTAAN SQPQQRSQAS GNQPPSILGQ GGSAQNMGPR
510 520 530 540 550
PGAPSQGLFG QPSSRLAPAS NMTSQRPVSS TGINFDNPSV QKALDTLIQS
560 570
GPALSHLVSQ TTAQMGQPQA PMGSYQRHY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again