Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9HCD5 Nuclear receptor coactivator 5 n=146 Tax=Eutheria TaxID=9347 RepID=NCOA5_HUMAN MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 146  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6LBZ8Q6LBZ8_RABITTroponin C messenger (aa 132 to 148) (Fragment)Oryctolagus cuniculus (Rabbit)9986UniRef100_F6TDW3
17
Q6LBZ9Q6LBZ9_RABITTroponin C messenger (aa 73 to 102) (fast muscle) (Fragment)Oryctolagus cuniculus (Rabbit)9986UniRef100_F6TDW3
30
A0A452SV09A0A452SV09_URSAMUncharacterized proteinUrsus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A384CN90
299
UPI0010F709D2nuclear receptor coactivator 5 isoform X5Monodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_A0A2Y9MI38
355
UPI0000D45FCDnuclear receptor coactivator 5 isoform 2Homo sapiens (Human)9606UniRef100_Q9HCD5
474
UPI000511E83Anuclear receptor coactivator 5 isoform X2Pan troglodytes (Chimpanzee)9598UniRef100_H2R0R9
474
A0A3Q0DXK5A0A3Q0DXK5_TARSYnuclear receptor coactivator 5 isoform X2Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TI72
496
UPI0004F02A54nuclear receptor coactivator 5 isoform X1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7I0W5
496
UPI0003AB53AFnuclear receptor coactivator 5 isoform X2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5VH25
502
UPI0004F1F737nuclear receptor coactivator 5 isoform X3Papio anubis (Olive baboon)9555UniRef100_A0A2I3LQ59
502
UPI000533DE6Bnuclear receptor coactivator 5 isoform X1Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6U7Q5
502
UPI000CEF73F4nuclear receptor coactivator 5 isoform X1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XVC7
502
UPI000C2FD003nuclear receptor coactivator 5 isoform X2Felis catus (Cat) (Felis silvestris catus)9685UniRef100_M3X584
502
UPI0006251078nuclear receptor coactivator 5 isoform X2Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5E4M9
502
UPI000DC1802Cnuclear receptor coactivator 5 isoform X2Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC15E6A
502
UPI0009059EBEnuclear receptor coactivator 5 isoform X2Panthera pardus (Leopard) (Felis pardus)9691UniRef100_UPI00042C1409
502
UPI00080A466Anuclear receptor coactivator 5 isoform X2Cebus capucinus imitator1737458UniRef100_A0A2K5RA86
502
UPI00063F6E63nuclear receptor coactivator 5 isoform X2Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6EYV1
502
UPI0006438C31nuclear receptor coactivator 5 isoform X2Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI00017746AA
502
UPI000696634Bnuclear receptor coactivator 5 isoform X2Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)34839UniRef100_UPI00038EFDC4
509
A0A3Q7PBY5A0A3Q7PBY5_CALURnuclear receptor coactivator 5 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PCA2
526
A0A2U3Y7X7A0A2U3Y7X7_LEPWEnuclear receptor coactivator 5Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A3Q7PCA2
526
A0A2Y9GZC9A0A2Y9GZC9_NEOSCnuclear receptor coactivator 5 isoform X2Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A3Q7PCA2
526
A0A2Y9MNN6A0A2Y9MNN6_DELLEnuclear receptor coactivator 5 isoform X2Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9MI38
526
A0A3Q7UBJ9A0A3Q7UBJ9_VULVUnuclear receptor coactivator 5 isoform X2Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7TZ16
526

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9HCD5

Checksumi: D2ADCCEBEE566A91

FASTA57965,536
        10         20         30         40         50
MNTAPSRPSP TRRDPYGFGD SRDSRRDRSP IRGSPRREPR DGRNGRDARD
60 70 80 90 100
SRDIRDPRDL RDHRHSRDLR DHRDSRSVRD VRDVRDLRDF RDLRDSRDFR
110 120 130 140 150
DQRDPMYDRY RDMRDSRDPM YRREGSYDRY LRMDDYCRRK DDSYFDRYRD
160 170 180 190 200
SFDGRGPPGP ESQSRAKERL KREERRREEL YRQYFEEIQR RFDAERPVDC
210 220 230 240 250
SVIVVNKQTK DYAESVGRKV RDLGMVVDLI FLNTEVSLSQ ALEDVSRGGS
260 270 280 290 300
PFAIVITQQH QIHRSCTVNI MFGTPQEHRN MPQADAMVLV ARNYERYKNE
310 320 330 340 350
CREKEREEIA RQAAKMADEA ILQERERGGP EEGVRGGHPP AIQSLINLLA
360 370 380 390 400
DNRYLTAEET DKIINYLRER KERLMRSSTD SLPGPISRQP LGATSGASLK
410 420 430 440 450
TQPSSQPLQS GQVLPSATPT PSAPPTSQQE LQAKILSLFN SGTVTANSSS
460 470 480 490 500
ASPSVAAGNT PNQNFSTAAN SQPQQRSQAS GNQPPSILGQ GGSAQNMGPR
510 520 530 540 550
PGAPSQGLFG QPSSRLAPAS NMTSQRPVSS TGINFDNPSV QKALDTLIQS
560 570
GPALSHLVSQ TTAQMGQPQA PMGSYQRHY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again