Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9P2K3 REST corepressor 3 n=147 Tax=Amniota TaxID=32524 RepID=RCOR3_HUMAN MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQ ALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTI ASLVKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAK KEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT ILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQ GVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAEQGTQASNGDASTL GEETKSASNVPSGKSTDEEEEAQTPQAPRTLGPSPPAPSSTPTPTAPIATLNQPPPLLRP TLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLSTVGGQQP PSLIGIQTDSQSSLH

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 147  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9P2K3RCOR3_HUMANREST corepressor 3Homo sapiens (Human)9606UniRef100_Q9P2K3
495Representative
A0A2I3H9C4A0A2I3H9C4_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_Q9P2K3
563
A0A2J8V6E1A0A2J8V6E1_PONABRCOR3 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q9P2K3
495
A0A2J8QVF4A0A2J8QVF4_PANTRRCOR3 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q9P2K3
495
A0A2R9B2Y1A0A2R9B2Y1_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q9P2K3
497
A0A2I2YIU3A0A2I2YIU3_GORGOREST corepressor 3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q9P2K3
497
A0A4W2GSB4A0A4W2GSB4_BOBOXREST corepressor 3Bos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2GSB4
639Seed
A0A212CR02A0A212CR02_CEREHUncharacterized protein (Fragment)Cervus elaphus hippelaphus (European red deer)46360UniRef100_A0A4W2GSB4
99
A0A480EPV2A0A480EPV2_PIGREST corepressor 3 isoform aSus scrofa (Pig)9823UniRef100_A0A480EPV2
576
A0A3Q7QZT7A0A3Q7QZT7_CALURREST corepressor 3 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7QZT7
556
A0A3Q7QZU2A0A3Q7QZU2_CALURREST corepressor 3 isoform X5Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7QZT7
432
F7AG51F7AG51_HORSEREST corepressor 3Equus caballus (Horse)9796UniRef100_F7AG51
555
A0A480XXZ3A0A480XXZ3_PIGREST corepressor 3 isoform X3Sus scrofa (Pig)9823UniRef100_A0A480XXZ3
555
A0A286ZTG5A0A286ZTG5_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A480XXZ3
496
A0A4X1TKH5A0A4X1TKH5_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A480XXZ3
496
A0A3Q7PU63A0A3Q7PU63_CALURREST corepressor 3 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PU63
555
M3X6R3M3X6R3_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3X6R3
555
A0A2J8QVE9A0A2J8QVE9_PANTRRCOR3 isoform 6Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8QVE9
554
F7H8A0F7H8A0_CALJAREST corepressor 3Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7H8A0
554
A0A2K6S7M6A0A2K6S7M6_SAIBBREST corepressor 3Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_F7H8A0
495
A0A340WUV9A0A340WUV9_LIPVEREST corepressor 3 isoform X2Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WUV9
554
A0A2Y9Q0V4A0A2Y9Q0V4_DELLEREST corepressor 3 isoform X1Delphinapterus leucas (Beluga whale)9749UniRef100_A0A340WUV9
554
A0A480K055A0A480K055_PIGREST corepressor 3 isoform aSus scrofa (Pig)9823UniRef100_A0A480K055
554
A0A2Y9QXS8A0A2Y9QXS8_TRIMAREST corepressor 3 isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9QXS8
554
A0A2Y9R354A0A2Y9R354_TRIMAREST corepressor 3 isoform X5Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9QXS8
432

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9P2K3

Checksumi: 2673C9DDD3C176E4

FASTA49555,581
        10         20         30         40         50
MRVGAEYQAR IPEFDPGATK YTDKDNGGML VWSPYHSIPD AKLDEYIAIA
60 70 80 90 100
KEKHGYNVEQ ALGMLFWHKH NIEKSLADLP NFTPFPDEWT VEDKVLFEQA
110 120 130 140 150
FSFHGKSFHR IQQMLPDKTI ASLVKYYYSW KKTRSRTSLM DRQARKLANR
160 170 180 190 200
HNQGDSDDDV EETHPMDGND SDYDPKKEAK KEGNTEQPVQ TSKIGLGRRE
210 220 230 240 250
YQSLQHRHHS QRSKCRPPKG MYLTQEDVVA VSCSPNAANT ILRQLDMELI
260 270 280 290 300
SLKRQVQNAK QVNSALKQKM EGGIEEFKPP ESNQKINARW TTEEQLLAVQ
310 320 330 340 350
GVRKYGKDFQ AIADVIGNKT VGQVKNFFVN YRRRFNLEEV LQEWEAEQGT
360 370 380 390 400
QASNGDASTL GEETKSASNV PSGKSTDEEE EAQTPQAPRT LGPSPPAPSS
410 420 430 440 450
TPTPTAPIAT LNQPPPLLRP TLPAAPALHR QPPPLQQQAR FIQPRPTLNQ
460 470 480 490
PPPPLIRPAN SMPPRLNPRP VLSTVGGQQP PSLIGIQTDS QSSLH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again