Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9P8P2 Phospholipase B n=94 Tax=Cryptococcus TaxID=5206 RepID=PLB1_CRYNH MSIATATFAFSLFATIAFAVPPETPRIELQAERGLGDKSYAPWQVDCPSNVTWIRNATTG LGSGERAYIEAREKLVQPVIEQMMAARGLETPPRTPNIGVALSGGGYRAMLTGLGGIMGM MNESTEASESETGGWLDGVSYWAGLSGGSWATGTFMSNGGQLPTNLLENLWNIDSNLVFP DDDKLSFYTELYTETNAKSDLGFPIQITDVWGLAIGSHVLPERYQLSNTPNLTFSSLPSV VSALGNASLPMPIIIAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD LGEDQADISRIPNTFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA FDSSYDTDYIWPNGTALRTTYERAKVLAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC NDTTTPLIIYVPSYPWSFAANTSTYQLSYENDEANEMLLNGMRSLTLNHSVPTWPTCFAC ALTDRSFMYTSENRSTTCQKCFDTWCWAGDDNTTEPATYEPVINSVPPWLVANNLSIGVA DAPASNESTAGTASSGAAKADVSMGMVALAAGLGLML

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 94  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9P8P2PLB1_CRYNHPhospholipase BCryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) (Filobasidiella neoformans var. grubii)235443UniRef100_Q9P8P2
637Representative
P0CP75PLB1_CRYNBPhospholipase BCryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)283643UniRef100_P0CP75
637Seed
P0CP74PLB1_CRYNJPhospholipase BCryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)214684UniRef100_P0CP75
637
F6M7X2F6M7X2_CRYNVLysophospholipase (Fragment)Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)178876UniRef100_Q9P8P2
124
E0XFN9E0XFN9_CRYNVLysophospholipase (Fragment)Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)178876UniRef100_Q9P8P2
123
E0XFP0E0XFP0_CRYNELysophospholipase (Fragment)Cryptococcus neoformans (Filobasidiella neoformans)5207UniRef100_Q9P8P2
123
E1VDS3E1VDS3_CRYNELysophospholipase (Fragment)Cryptococcus neoformans (Filobasidiella neoformans)5207UniRef100_Q9P8P2
139
Q2Q4M8Q2Q4M8_CRYNELysophospholipase (Fragment)Cryptococcus neoformans (Filobasidiella neoformans)5207UniRef100_Q9P8P2
119
E0XFP2E0XFP2_CRYNELysophospholipase (Fragment)Cryptococcus neoformans (Filobasidiella neoformans)5207UniRef100_P0CP75
123
E6RF48E6RF48_CRYGWLysophospholipaseCryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)367775UniRef100_E6RF48
634
Q96WX0Q96WX0_CRYGALysophospholipaseCryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
634
A0A0D0Y827A0A0D0Y827_9TREELysophospholipaseCryptococcus gattii EJB21296103UniRef100_E6RF48
634
B9U0Z1B9U0Z1_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
577
G4VV72G4VV72_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
128
Q30HF2Q30HF2_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
145
A0A068BHZ2A0A068BHZ2_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
184
A0A0H3U370A0A0H3U370_9TREELysophospholipase (Fragment)Cryptococcus gattii VGI37769UniRef100_E6RF48
123
E0XFM4E0XFM4_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_E6RF48
123
E0XFQ3E0XFQ3_CRYNELysophospholipase (Fragment)Cryptococcus neoformans (Filobasidiella neoformans)5207UniRef100_E6RF48
123
I6Z2R1I6Z2R1_CRYNVLysophospholipase (Fragment)Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)178876UniRef100_E6RF48
123
A0A0D0UX28A0A0D0UX28_9TREELysophospholipaseCryptococcus gattii VGII Ram51296110UniRef100_A0A0D0UX28
634
B9U101B9U101_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_A0A0D0UX28
577
A9X6R0A9X6R0_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_A0A0D0UX28
157
Q30HF1Q30HF1_CRYGALysophospholipase (Fragment)Cryptococcus gattii (Filobasidiella gattii) (Cryptococcus bacillisporus)552467UniRef100_A0A0D0UX28
145
A0A0H3U534A0A0H3U534_9TREELysophospholipase (Fragment)Cryptococcus gattii VGI37769UniRef100_A0A0D0UX28
123

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9P8P2

Checksumi: 7C052A69669B2276

FASTA63768,818
        10         20         30         40         50
MSIATATFAF SLFATIAFAV PPETPRIELQ AERGLGDKSY APWQVDCPSN
60 70 80 90 100
VTWIRNATTG LGSGERAYIE AREKLVQPVI EQMMAARGLE TPPRTPNIGV
110 120 130 140 150
ALSGGGYRAM LTGLGGIMGM MNESTEASES ETGGWLDGVS YWAGLSGGSW
160 170 180 190 200
ATGTFMSNGG QLPTNLLENL WNIDSNLVFP DDDKLSFYTE LYTETNAKSD
210 220 230 240 250
LGFPIQITDV WGLAIGSHVL PERYQLSNTP NLTFSSLPSV VSALGNASLP
260 270 280 290 300
MPIIIAADRK RREAGELVIA ENATVWEFTP YEFGSWAFGS QYKSPGAFTP
310 320 330 340 350
IEYLGTSVDD GSPNGTCWKG FDQLSFVMGT SATLFNGAFL ELNGTDSGLL
360 370 380 390 400
TNLITAFLAD LGEDQADISR IPNTFSNYNS GENPIYNLTY ITLVDAGETN
410 420 430 440 450
QNIPLEPLLV PTRDVDAIVA FDSSYDTDYI WPNGTALRTT YERAKVLAEH
460 470 480 490 500
ENTRVLMPEV PSMNGFVNGG YNSRPTFFGC NDTTTPLIIY VPSYPWSFAA
510 520 530 540 550
NTSTYQLSYE NDEANEMLLN GMRSLTLNHS VPTWPTCFAC ALTDRSFMYT
560 570 580 590 600
SENRSTTCQK CFDTWCWAGD DNTTEPATYE PVINSVPPWL VANNLSIGVA
610 620 630
DAPASNESTA GTASSGAAKA DVSMGMVALA AGLGLML
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again