Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9QYR7 Acyl-coenzyme A thioesterase 3 n=5 Tax=Mus TaxID=10088 RepID=ACOT3_MOUSE MHAFTTQNPNRMAPTVILEPAGGCLCDQPVHIAVRGLAPEQPVTLRSVLRDEKGALFRAH ARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQTPFVVELEVL DGHEPDGGQRLARAVHERHFMAPGVRRVPVREGRVRATLFLPPGTGPFPGIIDLFGIGSG LLEYRASLLAGKGFAVMALAYNNYEDLPKDMDIIHLEYFEEAVTYLLSHPQVTGSGVGVL GISKGGELGFAMASFLKNITAAVIINGSISNIGGNLQYKDETVPSVGINTKRVKRTKDGL KDIVDLLNNPLEGPDQKSLIPVERSDTAFLFLVGQDDHNWKSEFYAREASKRLQAHGKEK PQIICYPETGHHIEPPYFPLCKASLNSLVGGPVIWGGEPRAHAMAQVDAWQQLQTFFHNH LDGKKKTIPAKL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9QYR7ACOT3_MOUSEAcyl-coenzyme A thioesterase 3Mus musculus (Mouse)10090UniRef100_Q9QYR7
432Representative & Seed
Q53YL1Q53YL1_MOUSEAcyl-CoA thioesterase 3Mus musculus (Mouse)10090UniRef100_Q9QYR7
432
Q9QYR7-2Isoform 2 of ACOT3_MOUSE2, PTE-Ia 5':2Mus musculus (Mouse)10090UniRef100_Q9QYR7
421
UPI000A316014acyl-coenzyme A thioesterase 3Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A316014
432
UPI000A3090CCLOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 3-likeMus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A3090CC
430

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9QYR7

Checksumi: BF5888C59C015359

FASTA43247,489
        10         20         30         40         50
MHAFTTQNPN RMAPTVILEP AGGCLCDQPV HIAVRGLAPE QPVTLRSVLR
60 70 80 90 100
DEKGALFRAH ARYRADSHGE LDLARTPALG GSFSGLEPMG LLWAMEPDRP
110 120 130 140 150
FWRLIKRDVQ TPFVVELEVL DGHEPDGGQR LARAVHERHF MAPGVRRVPV
160 170 180 190 200
REGRVRATLF LPPGTGPFPG IIDLFGIGSG LLEYRASLLA GKGFAVMALA
210 220 230 240 250
YNNYEDLPKD MDIIHLEYFE EAVTYLLSHP QVTGSGVGVL GISKGGELGF
260 270 280 290 300
AMASFLKNIT AAVIINGSIS NIGGNLQYKD ETVPSVGINT KRVKRTKDGL
310 320 330 340 350
KDIVDLLNNP LEGPDQKSLI PVERSDTAFL FLVGQDDHNW KSEFYAREAS
360 370 380 390 400
KRLQAHGKEK PQIICYPETG HHIEPPYFPL CKASLNSLVG GPVIWGGEPR
410 420 430
AHAMAQVDAW QQLQTFFHNH LDGKKKTIPA KL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again