Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9R0C0 Biogenesis of lysosome-related organelles complex 1 subunit 6 n=10 Tax=Boreoeutheria TaxID=1437010 RepID=BL1S6_MOUSE MSVPEPPPPDGVLTGPSDSLEAGEPTPGLSDTSPDEGLIEDFPVDDRAVEHLVGGLLSHY LPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVTIRK EMLLLHEKTSKLKKRALKLQQKRQREELEREQQREKEFEREKQLTAKPAKRT

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
UPI000A3192C0biogenesis of lysosome-related organelles complex 1 subunit 6Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A3192C0
172
UPI00126172F1biogenesis of lysosome-related organelles complex 1 subunit 6Mastomys coucha (Southern multimammate mouse) (Praomys coucha)35658UniRef100_UPI00126172F1
172
UPI00032ADA7Abiogenesis of lysosome-related organelles complex 1 subunit 6Ochotona princeps (Southern American pika)9978UniRef100_UPI00032ADA7A
172
UPI000A314403biogenesis of lysosome-related organelles complex 1 subunit 6Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A314403
172

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9R0C0

Checksumi: 6B8068DF091B07D2

FASTA17219,682
        10         20         30         40         50
MSVPEPPPPD GVLTGPSDSL EAGEPTPGLS DTSPDEGLIE DFPVDDRAVE
60 70 80 90 100
HLVGGLLSHY LPDLQRSKRA LQELTQNQVV LLDTLEQEIS KFKECHSMLD
110 120 130 140 150
INALFTEAKH YHAKLVTIRK EMLLLHEKTS KLKKRALKLQ QKRQREELER
160 170
EQQREKEFER EKQLTAKPAK RT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again