Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9R0S2 Matrix metalloproteinase-24 n=39 Tax=Eutheria TaxID=9347 RepID=MMP24_MOUSE MPRSRGGRAAPGQASRWSGWRAPGRLLPLLPALCCLAAAAGAGKPAGADAPFAGQNWLKS YGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHL SRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVP YHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG NANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYG PPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKPNICDGNFNTV ALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDK YWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATD PGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWM GCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKN KAGPQPVTYYKRPVQEWV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 39  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9R0S2MMP24_MOUSEMatrix metalloproteinase-24Mus musculus (Mouse)10090UniRef100_Q9R0S2
618Representative
Q9Y5R2MMP24_HUMANMatrix metalloproteinase-24Homo sapiens (Human)9606UniRef100_Q9Y5R2
645
Q99PW6MMP24_RATMatrix metalloproteinase-24Rattus norvegicus (Rat)10116UniRef100_Q99PW6
618
A0A480DXR1A0A480DXR1_PIGMatrix metalloproteinase-24 isoform X3 (Fragment)Sus scrofa (Pig)9823UniRef100_A0A480DXR1
706
A0A2K5R744A0A2K5R744_CEBCAZnMc domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5R744
645
H2QK91H2QK91_PANTRMMP24 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q9Y5R2
645
Q86VV6Q86VV6_HUMANMMP24 protein (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5R2
626
F7G7S2F7G7S2_CALJAMatrix metallopeptidase 24Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7G7S2
645
A0A2Y9ISI8A0A2Y9ISI8_ENHLUmatrix metalloproteinase-24Enhydra lutris kenyoni391180UniRef100_A0A2Y9ISI8
630
I3MKD7I3MKD7_ICTTRZnMc domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3MKD7
621
A0A287DE29A0A287DE29_ICTTRZnMc domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3MKD7
573
A0A3Q7PE03A0A3Q7PE03_CALURmatrix metalloproteinase-24Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PE03
614
G1LT64G1LT64_AILMEMatrix metallopeptidase 24Ailuropoda melanoleuca (Giant panda)9646UniRef100_G1LT64
608
D2H446D2H446_AILMEZnMc domain-containing protein (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_G1LT64
564
A0A096NUQ1A0A096NUQ1_PAPANZnMc domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NUQ1
607
F7E951F7E951_MACMUZnMc domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A096NUQ1
573
A0A2K5LI89A0A2K5LI89_CERATZnMc domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A096NUQ1
573
A0A0D9RDJ2A0A0D9RDJ2_CHLSBZnMc domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A096NUQ1
573
A0A2K5VJD5A0A2K5VJD5_MACFAZnMc domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A096NUQ1
573
A0A2K6B6N9A0A2K6B6N9_MACNEZnMc domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A096NUQ1
573
B0CM76B0CM76_PAPANMatrix metallopeptidase 24 (Predicted)Papio anubis (Olive baboon)9555UniRef100_B0CM76
598
C3PT55C3PT55_DASNOMatrix metalloproteinase 24 preproprotein (Predicted), 5 prime (Fragment)Dasypus novemcinctus (Nine-banded armadillo)9361UniRef100_C3PT55
245
UPI000A30498Bmatrix metalloproteinase-24Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_Q9R0S2
592
UPI000DC693A9matrix metalloproteinase-24Canis lupus dingo (dingo)286419UniRef100_UPI000DC693A9
630
UPI00105AE30Ematrix metalloproteinase-24Phyllostomus discolor (pale spear-nosed bat)89673UniRef100_UPI00105AE30E
621

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9R0S2

Checksumi: 51C8E61B187264F5

FASTA61870,460
        10         20         30         40         50
MPRSRGGRAA PGQASRWSGW RAPGRLLPLL PALCCLAAAA GAGKPAGADA
60 70 80 90 100
PFAGQNWLKS YGYLLPYESR ASALHSGKAL QSAVSTMQQF YGIPVTGVLD
110 120 130 140 150
QTTIEWMKKP RCGVPDHPHL SRRRRNKRYA LTGQKWRQKH ITYSIHNYTP
160 170 180 190 200
KVGELDTRKA IRQAFDVWQK VTPLTFEEVP YHEIKSDRKE ADIMIFFASG
210 220 230 240 250
FHGDSSPFDG EGGFLAHAYF PGPGIGGDTH FDSDEPWTLG NANHDGNDLF
260 270 280 290 300
LVAVHELGHA LGLEHSNDPS AIMAPFYQYM ETHNFKLPQD DLQGIQKIYG
310 320 330 340 350
PPAEPLEPTR PLPTLPVRRI HSPSERKHER HPRPPRPPLG DRPSTPGAKP
360 370 380 390 400
NICDGNFNTV ALFRGEMFVF KDRWFWRLRN NRVQEGYPMQ IEQFWKGLPA
410 420 430 440 450
RIDAAYERAD GRFVFFKGDK YWVFKEVTVE PGYPHSLGEL GSCLPREGID
460 470 480 490 500
TALRWEPVGK TYFFKGERYW RYSEERRATD PGYPKPITVW KGIPQAPQGA
510 520 530 540 550
FISKEGYYTY FYKGRDYWKF DNQKLSVEPG YPRNILRDWM GCKQKEVERR
560 570 580 590 600
KERRLPQDDV DIMVTIDDVP GSVNAVAVVV PCTLSLCLLV LLYTIFQFKN
610
KAGPQPVTYY KRPVQEWV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again