Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9UG56 Phosphatidylserine decarboxylase proenzyme, mitochondrial n=54 Tax=Eutheria TaxID=9347 RepID=PISD_HUMAN MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPART MFLLRPLPILLVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLS RAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV CGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCTEDLPFPPAASCDSFK NQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR EGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 54  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9UG56PISD_HUMANPhosphatidylserine decarboxylase proenzyme, mitochondrialHomo sapiens (Human)9606UniRef100_Q9UG56
409Representative
Q5R8I8PISD_PONABPhosphatidylserine decarboxylase proenzyme, mitochondrialPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5R8I8
409
K9IXN0K9IXN0_DESROPhosphatidylserine decarboxylase proenzyme, mitochondrialDesmodus rotundus (Vampire bat)9430UniRef100_K9IXN0
409
A0A2Y9LAF7A0A2Y9LAF7_ENHLUPhosphatidylserine decarboxylase proenzyme, mitochondrialEnhydra lutris kenyoni391180UniRef100_A0A2Y9LAF7
409
A0A2K6PXI2A0A2K6PXI2_RHIROPhosphatidylserine decarboxylase proenzyme, mitochondrialRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PXI2
409
A0A2K6M0B8A0A2K6M0B8_RHIBEPhosphatidylserine decarboxylase proenzyme, mitochondrialRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6PXI2
409
A0A2J8UVI0A0A2J8UVI0_PONABPhosphatidylserine decarboxylase proenzyme, mitochondrialPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5R8I8
409
A0A2K6A407A0A2K6A407_MANLEPhosphatidylserine decarboxylase proenzyme, mitochondrialMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K6A407
409
F6QD13F6QD13_MACMUPhosphatidylserine decarboxylase proenzyme, mitochondrialMacaca mulatta (Rhesus macaque)9544UniRef100_F6QD13
409
A0A2K5M630A0A2K5M630_CERATPhosphatidylserine decarboxylase proenzyme, mitochondrialCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_F6QD13
409
A0A0D9R8F5A0A0D9R8F5_CHLSBPhosphatidylserine decarboxylase proenzyme, mitochondrialChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_F6QD13
409
A0A2K6C9F8A0A2K6C9F8_MACNEPhosphatidylserine decarboxylase proenzyme, mitochondrialMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6C9F8
409
H2QLI7H2QLI7_PANTRPhosphatidylserine decarboxylase proenzyme, mitochondrialPan troglodytes (Chimpanzee)9598UniRef100_H2QLI7
409
G3QXV3G3QXV3_GORGOPhosphatidylserine decarboxylase proenzyme, mitochondrialGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_H2QLI7
409
U6CWF5U6CWF5_NEOVIPhosphatidylserine decarboxylase proenzyme, mitochondrialNeovison vison (American mink) (Mustela vison)452646UniRef100_U6CWF5
409
A0A2K6S3A4A0A2K6S3A4_SAIBBPhosphatidylserine decarboxylase proenzyme, mitochondrialSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6S3A4
409
A0A2U3XPZ6A0A2U3XPZ6_LEPWEPhosphatidylserine decarboxylase proenzyme, mitochondrialLeptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3XPZ6
409
A0A096NJM9A0A096NJM9_PAPANPhosphatidylserine decarboxylase proenzyme, mitochondrialPapio anubis (Olive baboon)9555UniRef100_A0A096NJM9
409
A0A2R9CH99A0A2R9CH99_PANPAPhosphatidylserine decarboxylase proenzyme, mitochondrialPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CH99
409
A0A3Q7PDY3A0A3Q7PDY3_CALURPhosphatidylserine decarboxylase proenzyme, mitochondrialCallorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PDY3
409
A0A2K5U7R0A0A2K5U7R0_MACFAPhosphatidylserine decarboxylase proenzyme, mitochondrialMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5U7R0
409
G7PF90G7PF90_MACFAPhosphatidylserine decarboxylase proenzyme, mitochondrialMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PF90
409
A0A3Q7VRP9A0A3Q7VRP9_URSARPhosphatidylserine decarboxylase proenzyme, mitochondrialUrsus arctos horribilis116960UniRef100_A0A3Q7VRP9
409
A0A2K5E5K7A0A2K5E5K7_AOTNAPhosphatidylserine decarboxylase proenzyme, mitochondrialAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5E5K7
409
A0A2I3GDI2A0A2I3GDI2_NOMLEPhosphatidylserine decarboxylase proenzyme, mitochondrialNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GDI2
409

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9UG56

Checksumi: 6A5148265369D9DF

FASTA40946,672
        10         20         30         40         50
MATSVGHRCL GLLHGVAPWR SSLHPCEITA LSQSLQPLRK LPFRAFRTDA
60 70 80 90 100
RKIHTAPART MFLLRPLPIL LVTGGGYAGY RQYEKYRERE LEKLGLEIPP
110 120 130 140 150
KLAGHWEVAL YKSVPTRLLS RAWGRLNQVE LPHWLRRPVY SLYIWTFGVN
160 170 180 190 200
MKEAAVEDLH HYRNLSEFFR RKLKPQARPV CGLHSVISPS DGRILNFGQV
210 220 230 240 250
KNCEVEQVKG VTYSLESFLG PRMCTEDLPF PPAASCDSFK NQLVTREGNE
260 270 280 290 300
LYHCVIYLAP GDYHCFHSPT DWTVSHRRHF PGSLMSVNPG MARWIKELFC
310 320 330 340 350
HNERVVLTGD WKHGFFSLTA VGATNVGSIR IYFDRDLHTN SPRHSKGSYN
360 370 380 390 400
DFSFVTHTNR EGVPMRKGEH LGEFNLGSTI VLIFEAPKDF NFQLKTGQKI

RFGEALGSL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again