Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9UHB7 AF4/FMR2 family member 4 n=109 Tax=Eutheria TaxID=9347 RepID=AFF4_HUMAN MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYD EMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKWTPVGPAPSTSQS QKRSSGLQSGHSSQRTSAGSSSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSS PGKPQAVSSLNSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSTQSFPP SLMSKSNSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKI PSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGTG EQKRYNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEG ADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNK VNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGS ESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSR HKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKSREIIETDTSSSDSDESESLP PSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDL NLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESK KPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSS LKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSK PRRTKLVFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNA QESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKEN ALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASG SSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASI MTDLVRYTRQGLHWLRQDAKLIS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 109  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9UHB7AFF4_HUMANAF4/FMR2 family member 4Homo sapiens (Human)9606UniRef100_Q9UHB7
1,163Representative
A0A4W2HF37A0A4W2HF37_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2HF37
1,443Seed
A0A191VKH1A0A191VKH1_SHEEPGrowth differentiation factor 9 (Fragment)Ovis aries (Sheep)9940UniRef100_A0A4W2HF37
25
A0A4W2DAE6A0A4W2DAE6_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2DAE6
1,414
M3WGX3M3WGX3_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3WGX3
1,197
A0A485N8I9A0A485N8I9_LYNPAAf4 fmr2 family member 4-likeLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_M3WGX3
1,164
A0A2I2U697A0A2I2U697_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3WGX3
1,164
S7MSN4S7MSN4_MYOBRAF4/FMR2 family member 4Myotis brandtii (Brandt's bat)109478UniRef100_S7MSN4
1,187
A0A485MZ63A0A485MZ63_LYNPAAf4 fmr2 family member 4-likeLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485MZ63
1,171
A0A2J8LRZ4A0A2J8LRZ4_PANTRAFF4 isoform 6Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LRZ4
1,167
B7NZL7B7NZL7_RABITUncharacterized protein RA_m002_jsmFBA6BrOryctolagus cuniculus (Rabbit)9986UniRef100_B7NZL7
1,165
A0A2U3WHT7A0A2U3WHT7_ODOROAF4/FMR2 family member 4Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3WHT7
1,164
A0A4X1UXX1A0A4X1UXX1_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A4X1UXX1
1,164
A0A287B8T6A0A287B8T6_PIGAF4/FMR2 family member 4 isoform X1Sus scrofa (Pig)9823UniRef100_A0A4X1UXX1
1,164
A0A0B8RZS1A0A0B8RZS1_PIGAF4/FMR2 family, member 4Sus scrofa domesticus (domestic pig)9825UniRef100_A0A4X1UXX1
1,164
A0A2Y9RT09A0A2Y9RT09_TRIMAAF4/FMR2 family member 4 isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9RT09
1,164
A0A2Y9EQK4A0A2Y9EQK4_PHYMCAF4/FMR2 family member 4 isoform X1Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9EQK4
1,164
E1BCF6E1BCF6_BOVINAF4/FMR2 family member 4Bos taurus (Bovine)9913UniRef100_E1BCF6
1,164
A0A4W2DAH8A0A4W2DAH8_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_E1BCF6
1,164
A0A3Q7WQ52A0A3Q7WQ52_URSARAF4/FMR2 family member 4Ursus arctos horribilis116960UniRef100_A0A3Q7WQ52
1,164
F6SE46F6SE46_HORSEAF4/FMR2 family member 4Equus caballus (Horse)9796UniRef100_F6SE46
1,164
A0A452SN84A0A452SN84_URSAMAF4/FMR2 family member 4Ursus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A452SN84
1,164
G1PRH3G1PRH3_MYOLUUncharacterized proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1PRH3
1,164
H0XVP3H0XVP3_OTOGAAF4/FMR2 family member 4Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_H0XVP3
1,164
B2KIF2B2KIF2_RHIFEUncharacterized protein AFF4Rhinolophus ferrumequinum (Greater horseshoe bat)59479UniRef100_B2KIF2
1,164

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9UHB7

Checksumi: 474E1906B8832AC1

FASTA1,163127,459
        10         20         30         40         50
MNREDRNVLR MKERERRNQE IQQGEDAFPP SSPLFAEPYK VTSKEDKLSS
60 70 80 90 100
RIQSMLGNYD EMKDFIGDRS IPKLVAIPKP TVPPSADEKS NPNFFEQRHG
110 120 130 140 150
GSHQSSKWTP VGPAPSTSQS QKRSSGLQSG HSSQRTSAGS SSGTNSSGQR
160 170 180 190 200
HDRESYNNSG SSSRKKGQHG SEHSKSRSSS PGKPQAVSSL NSSHSRSHGN
210 220 230 240 250
DHHSKEHQRS KSPRDPDANW DSPSRVPFSS GQHSTQSFPP SLMSKSNSML
260 270 280 290 300
QKPTAYVRPM DGQESMEPKL SSEHYSSQSH GNSMTELKPS SKAHLTKLKI
310 320 330 340 350
PSQPLDASAS GDVSCVDEIL KEMTHSWPPP LTAIHTPCKT EPSKFPFPTK
360 370 380 390 400
ESQQSNFGTG EQKRYNPSKT SNGHQSKSML KDDLKLSSSE DSDGEQDCDK
410 420 430 440 450
TMPRSTPGSN SEPSHHNSEG ADNSRDDSSS HSGSESSSGS DSESESSSSD
460 470 480 490 500
SEANEPSQSA SPEPEPPPTN KWQLDNWLNK VNPHKVSPAS SVDSNIPSSQ
510 520 530 540 550
GYKKEGREQG TGNSYTDTSG PKETSSATPG RDSKTIQKGS ESGRGRQKSP
560 570 580 590 600
AQSDSTTQRR TVGKKQPKKA EKAAAEEPRG GLKIESETPV DLASSMPSSR
610 620 630 640 650
HKAATKGSRK PNIKKESKSS PRPTAEKKKY KSTSKSSQKS REIIETDTSS
660 670 680 690 700
SDSDESESLP PSSQTPKYPE SNRTPVKPSS VEEEDSFFRQ RMFSPMEEKE
710 720 730 740 750
LLSPLSEPDD RYPLIVKIDL NLLTRIPGKP YKETEPPKGE KKNVPEKHTR
760 770 780 790 800
EAQKQASEKV SNKGKRKHKN EDDNRASESK KPKTEDKNSA GHKPSSNRES
810 820 830 840 850
SKQSAAKEKD LLPSPAGPVP SKDPKTEHGS RKRTISQSSS LKSSSNSNKE
860 870 880 890 900
TSGSSKNSSS TSKQKKTEGK TSSSSKEVKE KAPSSSSNCP PSAPTLDSSK
910 920 930 940 950
PRRTKLVFDD RNYSADHYLQ EAKKLKHNAD ALSDRFEKAV YYLDAVVSFI
960 970 980 990 1000
ECGNALEKNA QESKSPFPMY SETVDLIKYT MKLKNYLAPD ATAADKRLTV
1010 1020 1030 1040 1050
LCLRCESLLY LRLFKLKKEN ALKYSKTLTE HLKNSYNNSQ APSPGLGSKA
1060 1070 1080 1090 1100
VGMPSPVSPK LSPGNSGNYS SGASSASASG SSVTIPQKIH QMAASYVQVT
1110 1120 1130 1140 1150
SNFLYATEIW DQAEQLSKEQ KEFFAELDKV MGPLIFNASI MTDLVRYTRQ
1160
GLHWLRQDAK LIS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again