Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9UKT5 F-box only protein 4 n=23 Tax=Catarrhini TaxID=9526 RepID=FBX4_HUMAN MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ DTEAETLTGFLNGIEWILEEVESKRAR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 23 of 23  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9UKT5FBX4_HUMANF-box only protein 4Homo sapiens (Human)9606UniRef100_Q9UKT5
387Representative
A0A2J8WBJ0A0A2J8WBJ0_PONABFBXO4 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WBJ0
388
F6Z9D2F6Z9D2_MACMUF-box domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6Z9D2
387
A0A2K5N257A0A2K5N257_CERATF-box domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5N257
387
G7P7F5G7P7F5_MACFAF-box only protein 4Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7P7F5
387
B3KNA0B3KNA0_HUMANcDNA FLJ14013 fis, clone Y79AA1002487, highly similar to F-box only protein 4Homo sapiens (Human)9606UniRef100_B3KNA0
387
H2PFG2H2PFG2_PONABF-box domain-containing proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PFG2
387
K7DFN4K7DFN4_PANTRF-box protein 4Pan troglodytes (Chimpanzee)9598UniRef100_K7DFN4
387
G3QRX4G3QRX4_GORGOF-box protein 4Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QRX4
387
A0A2K6RS77A0A2K6RS77_RHIROF-box domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RS77
387
A0A2R9BLX1A0A2R9BLX1_PANPAF-box domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BLX1
387
G1S3Z0G1S3Z0_NOMLEF-box domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1S3Z0
387
A0A2K6MRK9A0A2K6MRK9_RHIBEF-box domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6MRK9
375
A0A2J8WBH5A0A2J8WBH5_PONABFBXO4 isoform 6Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WBH5
362
UPI000013DC8DF-box only protein 4 isoform X3Homo sapiens (Human)9606UniRef100_Q9UKT5
243
UPI00122DA3E1F-box only protein 4 isoform X1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00122DA3E1
396Seed
UPI000DC160D7F-box only protein 4 isoform X1Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC160D7
388
UPI00083C38D0LOW QUALITY PROTEIN: F-box only protein 4Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_UPI00083C38D0
387
UPI0007DBE024F-box only protein 4 isoform X2Pan troglodytes (Chimpanzee)9598UniRef100_UPI0007DBE024
385
UPI0004F0710BF-box only protein 4 isoform X2Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI0004F0710B
385
UPI000B7B7A88F-box only protein 4 isoform X2Papio anubis (Olive baboon)9555UniRef100_UPI000B7B7A88
364
UPI0008F4E937F-box only protein 4 isoform X2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0008F4E937
361
UPI0012379990F-box only protein 4 isoform X3Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_UPI0012379990
359

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9UKT5

Checksumi: BD5E8DD14B9733E9

FASTA38744,136
        10         20         30         40         50
MAGSEPRSGT NSPPPPFSDW GRLEAAILSG WKTFWQSVSK ERVARTTSRE
60 70 80 90 100
EVDEAASTLT RLPIDVQLYI LSFLSPHDLC QLGSTNHYWN ETVRDPILWR
110 120 130 140 150
YFLLRDLPSW SSVDWKSLPD LEILKKPISE VTDGAFFDYM AVYRMCCPYT
160 170 180 190 200
RRASKSSRPM YGAVTSFLHS LIIQNEPRFA MFGPGLEELN TSLVLSLMSS
210 220 230 240 250
EELCPTAGLP QRQIDGIGSG VNFQLNNQHK FNILILYSTT RKERDRAREE
260 270 280 290 300
HTSAVNKMFS RHNEGDDQQG SRYSVIPQIQ KVCEVVDGFI YVANAEAHKR
310 320 330 340 350
HEWQDEFSHI MAMTDPAFGS SGRPLLVLSC ISQGDVKRMP CFYLAHELHL
360 370 380
NLLNHPWLVQ DTEAETLTGF LNGIEWILEE VESKRAR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again