Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9Y5U2-2 Isoform 2 of Protein TSSC4 n=17 Tax=Catarrhini TaxID=9526 RepID=Isoform 2 of TSSC4_HUMAN MAEAGTGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKR PLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQATALA FLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLG NPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVETVGF HGSRKRSRDHFRNKSSSPEDPGAEV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y5U2-2Isoform 2 of TSSC4_HUMAN2Homo sapiens (Human)9606UniRef100_Q9Y5U2-2
265Representative
H2NCG9H2NCG9_PONABTSSC4 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NCG9
265Seed
A0A2J8S6H2A0A2J8S6H2_PONABTSSC4 isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NCG9
208
A0A2K5ZZ92A0A2K5ZZ92_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZZ92
265
A0A2K6NUI7A0A2K6NUI7_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6NUI7
265
A0A2K6N149A0A2K6N149_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6N149
265
G3QX83G3QX83_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QX83
265
F7AV71F7AV71_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7AV71
265
A0A2K6D9W4A0A2K6D9W4_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_F7AV71
265
A0A2K5X637A0A2K5X637_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5X637
265
H2Q2X0H2Q2X0_PANTRTSSC4 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2Q2X0
265
A0A2R8ZVB3A0A2R8ZVB3_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_H2Q2X0
265
C9JJV1C9JJV1_HUMANProtein TSSC4 (Fragment)Homo sapiens (Human)9606UniRef100_H2Q2X0
207
A0A2J8JV34A0A2J8JV34_PANTRTSSC4 isoform 6 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_H2Q2X0
208
A0A2K5HIK7A0A2K5HIK7_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HIK7
265
UPI000E6AE6D9protein TSSC4 isoform X2Piliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000E6AE6D9
265
UPI000DC1B6CEprotein TSSC4 isoform X2Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC1B6CE
265

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y5U2-2

Checksumi: 72811C9774FC24C4

FASTA26527,935
        10         20         30         40         50
MAEAGTGLLP ATVQPFHLRG MSSTFSQRSR DIFDCLEGAA RRAPSSVAHT
60 70 80 90 100
SMSDNGGFKR PLAPSGRSPV EGLGRAHRSP ASPRVPPVPD YVAHPERWTK
110 120 130 140 150
YSLEDVTEVS EQSNQATALA FLGSQSLAAP TDCVSSFNQD PSSCGEGRVI
160 170 180 190 200
FTKPVRGVEA RHERKRVLGK VGEPGRGGLG NPATDRGEGP VELAHLAGPG
210 220 230 240 250
SPEAEEWGSH HGGLQEVEAL SGSVHSGSVP GLPPVETVGF HGSRKRSRDH
260
FRNKSSSPED PGAEV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again