Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9Y6L6 Solute carrier organic anion transporter family member 1B1 n=25 Tax=Catarrhini TaxID=9526 RepID=SO1B1_HUMAN MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE NGSVMDEANLESLNKNKHFVPSAGADSETHC

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y6L6SO1B1_HUMANSolute carrier organic anion transporter family member 1B1Homo sapiens (Human)9606UniRef100_Q9Y6L6
691Representative & Seed
A0A024RAU7A0A024RAU7_HUMANSolute carrier organic anion transporter family memberHomo sapiens (Human)9606UniRef100_Q9Y6L6
691
K4P403K4P403_HUMANOrganic anion transporting polypeptide (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y6L6
150
A0A096NF06A0A096NF06_PAPANSolute carrier organic anion transporter family memberPapio anubis (Olive baboon)9555UniRef100_A0A096NF06
691
A0A0D9R6M9A0A0D9R6M9_CHLSBSolute carrier organic anion transporter family memberChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R6M9
691
H2NGS3H2NGS3_PONABSolute carrier organic anion transporter family memberPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NGS3
691
A0A2K5N0T6A0A2K5N0T6_CERATSolute carrier organic anion transporter family memberCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5N0T6
691
H2Q5K6H2Q5K6_PANTRSolute carrier organic anion transporter family memberPan troglodytes (Chimpanzee)9598UniRef100_H2Q5K6
691
A0A2R9AN29A0A2R9AN29_PANPASolute carrier organic anion transporter family memberPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9AN29
691
G7PK03G7PK03_MACFASolute carrier organic anion transporter family memberMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PK03
691
L7TEQ7L7TEQ7_MACFASolute carrier organic anion transporter family memberMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_L7TEQ7
691
F6UHW9F6UHW9_MACMUSolute carrier organic anion transporter family memberMacaca mulatta (Rhesus macaque)9544UniRef100_F6UHW9
691
G7N6H2G7N6H2_MACMUSolute carrier organic anion transporter family member (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7N6H2
690
G1QXS7G1QXS7_NOMLESolute carrier organic anion transporter family memberNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1QXS7
690
G3SG45G3SG45_GORGOSolute carrier organic anion transporter family memberGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3SG45
687
UPI0005125E51solute carrier organic anion transporter family member 1B1 isoform X2Pan troglodytes (Chimpanzee)9598UniRef100_H2Q5K6
663
UPI000DC1A4E6solute carrier organic anion transporter family member 1B1Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC1A4E6
691
UPI0001FA2791solute carrier organic anion transporter family member 1B1 isoform X1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0001FA2791
691
UPI0005F3EF4Csolute carrier organic anion transporter family member 1B1Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_UPI0005F3EF4C
690
UPI0008F47A18solute carrier organic anion transporter family member 1B1 isoform X2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0008F47A18
665
UPI00123EC982solute carrier organic anion transporter family member 1B1 isoform X3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI00123EC982
659
UPI000D09BA7Dsolute carrier organic anion transporter family member 1B1 isoform X3Pan troglodytes (Chimpanzee)9598UniRef100_UPI000D09BA7D
659
UPI0008F4CA05solute carrier organic anion transporter family member 1B1 isoform X2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0008F4CA05
633
UPI00123E6B7Dsolute carrier organic anion transporter family member 1B1 isoform X4Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI00123E6B7D
610
UPI0008F5191Esolute carrier organic anion transporter family member 1B1 isoform X3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0008F5191E
584

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y6L6

Checksumi: D13D5130189383A3

FASTA69176,449
        10         20         30         40         50
MDQNQHLNKT AEAQPSENKK TRYCNGLKMF LAALSLSFIA KTLGAIIMKS
60 70 80 90 100
SIIHIERRFE ISSSLVGFID GSFEIGNLLV IVFVSYFGSK LHRPKLIGIG
110 120 130 140 150
CFIMGIGGVL TALPHFFMGY YRYSKETNIN SSENSTSTLS TCLINQILSL
160 170 180 190 200
NRASPEIVGK GCLKESGSYM WIYVFMGNML RGIGETPIVP LGLSYIDDFA
210 220 230 240 250
KEGHSSLYLG ILNAIAMIGP IIGFTLGSLF SKMYVDIGYV DLSTIRITPT
260 270 280 290 300
DSRWVGAWWL NFLVSGLFSI ISSIPFFFLP QTPNKPQKER KASLSLHVLE
310 320 330 340 350
TNDEKDQTAN LTNQGKNITK NVTGFFQSFK SILTNPLYVM FVLLTLLQVS
360 370 380 390 400
SYIGAFTYVF KYVEQQYGQP SSKANILLGV ITIPIFASGM FLGGYIIKKF
410 420 430 440 450
KLNTVGIAKF SCFTAVMSLS FYLLYFFILC ENKSVAGLTM TYDGNNPVTS
460 470 480 490 500
HRDVPLSYCN SDCNCDESQW EPVCGNNGIT YISPCLAGCK SSSGNKKPIV
510 520 530 540 550
FYNCSCLEVT GLQNRNYSAH LGECPRDDAC TRKFYFFVAI QVLNLFFSAL
560 570 580 590 600
GGTSHVMLIV KIVQPELKSL ALGFHSMVIR ALGGILAPIY FGALIDTTCI
610 620 630 640 650
KWSTNNCGTR GSCRTYNSTS FSRVYLGLSS MLRVSSLVLY IILIYAMKKK
660 670 680 690
YQEKDINASE NGSVMDEANL ESLNKNKHFV PSAGADSETH C
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again