Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+] n=4 Tax=Aeropyrum TaxID=56635 RepID=G1PDH_AERPE MYTSFHRIDLPRTIVVGGGVLDKAGGYVSGVAQRGSYVLVVSGPTVSSKYFERLRASLEA EGLTVGLKIIRDATVETAEEVAREALESRIEVVAGLGGGKSIDVAKYASKRAGSVFVSIP TVASHDGITSPFSSLKGFDKPISRPAKAPEAIIIDVDVIAEAPRRYNIAGFGDLIGKYTA VLDWRLAHKLRLEYYGEYAASLALLSAKHVSQYAEEIALGTREGYRVLLEALVSSGVSMC IAGSTRPASGSEHLFAHALHIVARNKPLHGEAVGVGTIMMAYLHGKNWRRIRGLLKTVGA PTNAKELGVEDDEVVEALTIAARIRPERYTILGEKGLTREAAEALARKTGVI

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
UPI0009EACF68NAD(P)-dependent glycerol-1-phosphate dehydrogenaseAeropyrum camini229980UniRef100_U3TEW2
352

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9YER2

Checksumi: 47E7CA60E02FEDD7

FASTA35237,667
        10         20         30         40         50
MYTSFHRIDL PRTIVVGGGV LDKAGGYVSG VAQRGSYVLV VSGPTVSSKY
60 70 80 90 100
FERLRASLEA EGLTVGLKII RDATVETAEE VAREALESRI EVVAGLGGGK
110 120 130 140 150
SIDVAKYASK RAGSVFVSIP TVASHDGITS PFSSLKGFDK PISRPAKAPE
160 170 180 190 200
AIIIDVDVIA EAPRRYNIAG FGDLIGKYTA VLDWRLAHKL RLEYYGEYAA
210 220 230 240 250
SLALLSAKHV SQYAEEIALG TREGYRVLLE ALVSSGVSMC IAGSTRPASG
260 270 280 290 300
SEHLFAHALH IVARNKPLHG EAVGVGTIMM AYLHGKNWRR IRGLLKTVGA
310 320 330 340 350
PTNAKELGVE DDEVVEALTI AARIRPERYT ILGEKGLTRE AAEALARKTG

VI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again