Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 200 (16 Oct 2019)
Sequence version 1 (01 Jul 1989)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

T-cell-specific surface glycoprotein CD28

Gene

CD28

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation (PubMed:8617933). Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells (PubMed:15067037).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • coreceptor activity Source: UniProtKB
  • identical protein binding Source: UniProtKB
  • protease binding Source: BHF-UCL
  • protein kinase binding Source: Ensembl
  • SH3/SH2 adaptor activity Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-164939 Nef mediated downregulation of CD28 cell surface expression
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-389356 CD28 co-stimulation
R-HSA-389357 CD28 dependent PI3K/Akt signaling
R-HSA-389359 CD28 dependent Vav1 pathway
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P10747

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P10747

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-cell-specific surface glycoprotein CD28
Alternative name(s):
TP44
CD_antigen: CD28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1653 CD28

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
186760 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P10747

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini19 – 152ExtracellularSequence analysisAdd BLAST134
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei153 – 179HelicalSequence analysisAdd BLAST27
Topological domaini180 – 220CytoplasmicSequence analysisAdd BLAST41

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
940

MalaCards human disease database

More...
MalaCardsi
CD28

Open Targets

More...
OpenTargetsi
ENSG00000178562

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2584 Classic mycosis fungoides
3162 Sezary syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26207

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P10747

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5191

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2863

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CD28

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115973

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Add BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001465219 – 220T-cell-specific surface glycoprotein CD28Add BLAST202

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi37N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi40 ↔ 1121 Publication
Disulfide bondi66 ↔ 861 Publication
Glycosylationi71N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi92N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi105N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi129N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei189PhosphoserineCombined sources1
Modified residuei191PhosphotyrosineCombined sources1
Modified residuei209PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

CD40LG induces tyrosine phosphorylation of isoform 3.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P10747

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P10747

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P10747

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P10747

PeptideAtlas

More...
PeptideAtlasi
P10747

PRoteomics IDEntifications database

More...
PRIDEi
P10747

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
52645 [P10747-1]
52646 [P10747-2]
52647 [P10747-3]
52648 [P10747-4]
52649 [P10747-5]
52650 [P10747-6]
68570

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P10747

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P10747

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in T-cells and plasma cells, but not in less mature B-cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000178562 Expressed in 103 organ(s), highest expression level in leukocyte

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P10747 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA070003

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked.

Interacts with DUSP14. Binds to CD80/B7-1 and CD86/B7-2/B70.

Interacts with GRB2.

Isoform 3 interacts with CD40LG (PubMed:15067037).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107378, 20 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P10747

Database of interacting proteins

More...
DIPi
DIP-6043N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P10747

Protein interaction database and analysis system

More...
IntActi
P10747, 10 interactors

Molecular INTeraction database

More...
MINTi
P10747

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000324890

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1220
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P10747

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P10747

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 137Ig-like V-typeAdd BLAST110

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IXMM Eukaryota
ENOG410Z063 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063873

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000276892

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P10747

KEGG Orthology (KO)

More...
KOi
K06470

Identification of Orthologs from Complete Genome Data

More...
OMAi
HQLQFHS

Database of Orthologous Groups

More...
OrthoDBi
890529at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P10747

TreeFam database of animal gene trees

More...
TreeFami
TF335679

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008093 CD28
IPR040216 CTLA4/CD28
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013106 Ig_V-set

The PANTHER Classification System

More...
PANTHERi
PTHR11494 PTHR11494, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15910 V-set_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01717 CD28ANTIGEN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00406 IGv, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P10747-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE
60 70 80 90 100
FRASLHKGLD SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ
110 120 130 140 150
NLYVNQTDIY FCKIEVMYPP PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS
160 170 180 190 200
KPFWVLVVVG GVLACYSLLV TVAFIIFWVR SKRSRLLHSD YMNMTPRRPG
210 220
PTRKHYQPYA PPRDFAAYRS
Length:220
Mass (Da):25,066
Last modified:July 1, 1989 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1D9B6552A5878D0F
GO
Isoform 2 (identifier: P10747-2) [UniParc]FASTAAdd to basket
Also known as: CD28-S2

The sequence of this isoform differs from the canonical sequence as follows:
     19-137: Missing.

Show »
Length:101
Mass (Da):11,528
Checksum:iF9B205F1D1BBFDC9
GO
Isoform 3 (identifier: P10747-3) [UniParc]FASTAAdd to basket
Also known as: CD28i

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y

Show »
Length:136
Mass (Da):15,369
Checksum:iC9AF33467706D2BE
GO
Isoform 4 (identifier: P10747-4) [UniParc]FASTAAdd to basket
Also known as: CD28-S1

The sequence of this isoform differs from the canonical sequence as follows:
     40-137: CKYSYNLFSR...SNGTIIHVKG → W

Show »
Length:123
Mass (Da):14,014
Checksum:i3DE54211F2642520
GO
Isoform 5 (identifier: P10747-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y
     138-139: KH → EE
     140-220: Missing.

Show »
Length:55
Mass (Da):6,099
Checksum:iA2F24E0CFBD16D90
GO
Isoform 6 (identifier: P10747-6) [UniParc]FASTAAdd to basket
Also known as: CD28-S3

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y
     152-207: Missing.

Show »
Length:80
Mass (Da):8,823
Checksum:iC09D0EC41F748AFC
GO
Isoform 7 (identifier: P10747-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MLRLLLALNLFPSIQVT → MPCGLSALIMCPKGMVAVVVAVDDGDSQALA

Show »
Length:234
Mass (Da):26,186
Checksum:i02AD85397834E57E
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0477011 – 17MLRLL…SIQVT → MPCGLSALIMCPKGMVAVVV AVDDGDSQALA in isoform 7. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_00249419 – 137Missing in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_00249640 – 137CKYSY…IHVKG → W in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_00249540 – 124CKYSY…PPYLD → Y in isoform 3, isoform 5 and isoform 6. 2 PublicationsAdd BLAST85
Alternative sequenceiVSP_002497138 – 139KH → EE in isoform 5. 1 Publication2
Alternative sequenceiVSP_002498140 – 220Missing in isoform 5. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_002499152 – 207Missing in isoform 6. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J02988 mRNA Translation: AAA60581.1
M37815
, M37812, M37813, M37814 Genomic DNA Translation: AAA51944.1
M37815
, M37812, M37813, M37814 Genomic DNA Translation: AAA51945.1
AJ295273 mRNA Translation: CAC29237.1
AF222341 mRNA Translation: AAF33792.1
AF222342 mRNA Translation: AAF33793.1
AF222343 mRNA Translation: AAF33794.1
AJ517504 mRNA Translation: CAD57003.1
EF064755 Genomic DNA Translation: ABK41938.1
AK292986 mRNA Translation: BAF85675.1
AK313313 mRNA Translation: BAG36118.1
AC125238 Genomic DNA Translation: AAY24123.1
CH471063 Genomic DNA Translation: EAW70348.1
BC093698 mRNA Translation: AAH93698.1
BC112085 mRNA Translation: AAI12086.1
AF411057 Genomic DNA Translation: AAL40931.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2361.1 [P10747-1]
CCDS58749.1 [P10747-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A39983 RWHU28

NCBI Reference Sequences

More...
RefSeqi
NP_001230006.1, NM_001243077.1 [P10747-4]
NP_001230007.1, NM_001243078.1 [P10747-2]
NP_006130.1, NM_006139.3 [P10747-1]
XP_011510496.1, XM_011512194.2 [P10747-7]
XP_011510499.1, XM_011512197.2 [P10747-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000324106; ENSP00000324890; ENSG00000178562 [P10747-1]
ENST00000374481; ENSP00000363605; ENSG00000178562 [P10747-2]
ENST00000458610; ENSP00000393648; ENSG00000178562 [P10747-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
940

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:940

UCSC genome browser

More...
UCSCi
uc002vah.6 human [P10747-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

CD28 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J02988 mRNA Translation: AAA60581.1
M37815
, M37812, M37813, M37814 Genomic DNA Translation: AAA51944.1
M37815
, M37812, M37813, M37814 Genomic DNA Translation: AAA51945.1
AJ295273 mRNA Translation: CAC29237.1
AF222341 mRNA Translation: AAF33792.1
AF222342 mRNA Translation: AAF33793.1
AF222343 mRNA Translation: AAF33794.1
AJ517504 mRNA Translation: CAD57003.1
EF064755 Genomic DNA Translation: ABK41938.1
AK292986 mRNA Translation: BAF85675.1
AK313313 mRNA Translation: BAG36118.1
AC125238 Genomic DNA Translation: AAY24123.1
CH471063 Genomic DNA Translation: EAW70348.1
BC093698 mRNA Translation: AAH93698.1
BC112085 mRNA Translation: AAI12086.1
AF411057 Genomic DNA Translation: AAL40931.1
CCDSiCCDS2361.1 [P10747-1]
CCDS58749.1 [P10747-2]
PIRiA39983 RWHU28
RefSeqiNP_001230006.1, NM_001243077.1 [P10747-4]
NP_001230007.1, NM_001243078.1 [P10747-2]
NP_006130.1, NM_006139.3 [P10747-1]
XP_011510496.1, XM_011512194.2 [P10747-7]
XP_011510499.1, XM_011512197.2 [P10747-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1YJDX-ray2.70C17-152[»]
3WA4X-ray1.35B189-196[»]
5AULX-ray1.10B189-196[»]
5GJHX-ray1.20B/D189-196[»]
5GJIX-ray0.90B189-196[»]
SMRiP10747
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107378, 20 interactors
CORUMiP10747
DIPiDIP-6043N
ELMiP10747
IntActiP10747, 10 interactors
MINTiP10747
STRINGi9606.ENSP00000324890

Chemistry databases

ChEMBLiCHEMBL5191
GuidetoPHARMACOLOGYi2863

PTM databases

iPTMnetiP10747
PhosphoSitePlusiP10747

Polymorphism and mutation databases

BioMutaiCD28
DMDMi115973

Proteomic databases

jPOSTiP10747
MassIVEiP10747
MaxQBiP10747
PaxDbiP10747
PeptideAtlasiP10747
PRIDEiP10747
ProteomicsDBi52645 [P10747-1]
52646 [P10747-2]
52647 [P10747-3]
52648 [P10747-4]
52649 [P10747-5]
52650 [P10747-6]
68570

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
P10747

Genome annotation databases

EnsembliENST00000324106; ENSP00000324890; ENSG00000178562 [P10747-1]
ENST00000374481; ENSP00000363605; ENSG00000178562 [P10747-2]
ENST00000458610; ENSP00000393648; ENSG00000178562 [P10747-7]
GeneIDi940
KEGGihsa:940
UCSCiuc002vah.6 human [P10747-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
940
DisGeNETi940

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CD28
HGNCiHGNC:1653 CD28
HPAiHPA070003
MalaCardsiCD28
MIMi186760 gene
neXtProtiNX_P10747
OpenTargetsiENSG00000178562
Orphaneti2584 Classic mycosis fungoides
3162 Sezary syndrome
PharmGKBiPA26207

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IXMM Eukaryota
ENOG410Z063 LUCA
GeneTreeiENSGT00530000063873
HOGENOMiHOG000276892
InParanoidiP10747
KOiK06470
OMAiHQLQFHS
OrthoDBi890529at2759
PhylomeDBiP10747
TreeFamiTF335679

Enzyme and pathway databases

ReactomeiR-HSA-1257604 PIP3 activates AKT signaling
R-HSA-164939 Nef mediated downregulation of CD28 cell surface expression
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-389356 CD28 co-stimulation
R-HSA-389357 CD28 dependent PI3K/Akt signaling
R-HSA-389359 CD28 dependent Vav1 pathway
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SignaLinkiP10747
SIGNORiP10747

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CD28 human
EvolutionaryTraceiP10747

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CD28

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
940
PharosiP10747

Protein Ontology

More...
PROi
PR:P10747

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000178562 Expressed in 103 organ(s), highest expression level in leukocyte
GenevisibleiP10747 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR008093 CD28
IPR040216 CTLA4/CD28
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013106 Ig_V-set
PANTHERiPTHR11494 PTHR11494, 1 hit
PfamiView protein in Pfam
PF15910 V-set_2, 1 hit
PRINTSiPR01717 CD28ANTIGEN
SMARTiView protein in SMART
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD28_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10747
Secondary accession number(s): A8KAC1
, Q13964, Q52M23, Q70WG0, Q8NI54, Q8NI55, Q8NI56, Q8WXJ2, Q9BYV0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: October 16, 2019
This is version 200 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again