Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 190 (31 Jul 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Guanine nucleotide exchange factor VAV3

Gene

VAV3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor
Biological processAngiogenesis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114604 GPVI-mediated activation cascade
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-2424491 DAP12 signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-3928665 EPH-ephrin mediated repulsion of cells
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5218920 VEGFR2 mediated vascular permeability

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9UKW4

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UKW4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Guanine nucleotide exchange factor VAV3
Short name:
VAV-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VAV3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12659 VAV3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605541 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UKW4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10451

Open Targets

More...
OpenTargetsi
ENSG00000134215

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37282

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VAV3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12643372

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809861 – 847Guanine nucleotide exchange factor VAV3Add BLAST847

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei141PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation can be mediated by ROS1. In osteoclasts, undergoes tyrosine phosphorylation in response to CSF1 (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UKW4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UKW4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UKW4

PeptideAtlas

More...
PeptideAtlasi
Q9UKW4

PRoteomics IDEntifications database

More...
PRIDEi
Q9UKW4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84896 [Q9UKW4-1]
84897 [Q9UKW4-2]
84898 [Q9UKW4-3]
84899 [Q9UKW4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UKW4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UKW4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated by EGF and TGF-beta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134215 Expressed in 203 organ(s), highest expression level in tongue squamous epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UKW4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UKW4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002012

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the PH domain of APS.

Interacts (via SH2 domains) with the phosphorylated form of EPHA2.

Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115715, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UKW4, 15 interactors

Molecular INTeraction database

More...
MINTi
Q9UKW4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359073

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1847
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UKW4

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UKW4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 119Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST119
Domaini192 – 371DHPROSITE-ProRule annotationAdd BLAST180
Domaini400 – 502PHPROSITE-ProRule annotationAdd BLAST103
Domaini592 – 660SH3 1PROSITE-ProRule annotationAdd BLAST69
Domaini672 – 766SH2PROSITE-ProRule annotationAdd BLAST95
Domaini788 – 847SH3 2PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni560 – 847Sufficient for interaction with ROS11 PublicationAdd BLAST288

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

Keywords - Domaini

Repeat, SH2 domain, SH3 domain, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2996 Eukaryota
ENOG410XPH6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155252

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234364

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UKW4

KEGG Orthology (KO)

More...
KOi
K05730

Identification of Orthologs from Complete Genome Data

More...
OMAi
HEFKMHT

Database of Orthologous Groups

More...
OrthoDBi
710582at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UKW4

TreeFam database of animal gene trees

More...
TreeFami
TF316171

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029 C1, 1 hit
cd00014 CH, 1 hit
cd01223 PH_Vav, 1 hit
cd00160 RhoGEF, 1 hit
cd10407 SH2_Vav3, 1 hit
cd11978 SH3_VAV3_2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022613 CAMSAP_CH
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037832 PH_Vav
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003096 SM22_calponin
IPR035881 VAV3_SH2
IPR035734 VAV3_SH3_2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00130 C1_1, 1 hit
PF11971 CAMSAP_CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00017 SH2, 1 hit
PF07653 SH3_2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401 SH2DOMAIN
PR00452 SH3DOMAIN
PR00888 SM22CALPONIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109 C1, 1 hit
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00252 SH2, 1 hit
SM00326 SH3, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 2 hits
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit
PS50002 SH3, 2 hits
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UKW4-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPWKQCAQW LIHCKVLPTN HRVTWDSAQV FDLAQTLRDG VLLCQLLNNL
60 70 80 90 100
RAHSINLKEI NLRPQMSQFL CLKNIRTFLT ACCETFGMRK SELFEAFDLF
110 120 130 140 150
DVRDFGKVIE TLSRLSRTPI ALATGIRPFP TEESINDEDI YKGLPDLIDE
160 170 180 190 200
TLVEDEEDLY DCVYGEDEGG EVYEDLMKAE EAHQPKCPEN DIRSCCLAEI
210 220 230 240 250
KQTEEKYTET LESIEKYFMA PLKRFLTAAE FDSVFINIPE LVKLHRNLMQ
260 270 280 290 300
EIHDSIVNKN DQNLYQVFIN YKERLVIYGQ YCSGVESAIS SLDYISKTKE
310 320 330 340 350
DVKLKLEECS KRANNGKFTL RDLLVVPMQR VLKYHLLLQE LVKHTTDPTE
360 370 380 390 400
KANLKLALDA MKDLAQYVNE VKRDNETLRE IKQFQLSIEN LNQPVLLFGR
410 420 430 440 450
PQGDGEIRIT TLDKHTKQER HIFLFDLAVI VCKRKGDNYE MKEIIDLQQY
460 470 480 490 500
KIANNPTTDK ENKKWSYGFY LIHTQGQNGL EFYCKTKDLK KKWLEQFEMA
510 520 530 540 550
LSNIRPDYAD SNFHDFKMHT FTRVTSCKVC QMLLRGTFYQ GYLCFKCGAR
560 570 580 590 600
AHKECLGRVD NCGRVNSGEQ GTLKLPEKRT NGLRRTPKQV DPGLPKMQVI
610 620 630 640 650
RNYSGTPPPA LHEGPPLQLQ AGDTVELLKG DAHSLFWQGR NLASGEVGFF
660 670 680 690 700
PSDAVKPCPC VPKPVDYSCQ PWYAGAMERL QAETELINRV NSTYLVRHRT
710 720 730 740 750
KESGEYAISI KYNNEAKHIK ILTRDGFFHI AENRKFKSLM ELVEYYKHHS
760 770 780 790 800
LKEGFRTLDT TLQFPYKEPE HSAGQRGNRA GNSLLSPKVL GIAIARYDFC
810 820 830 840
ARDMRELSLL KGDVVKIYTK MSANGWWRGE VNGRVGWFPS TYVEEDE
Length:847
Mass (Da):97,776
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC1E29F0B094CB721
GO
Isoform 2 (identifier: Q9UKW4-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: MEPWKQCAQW...DLFDVRDFGK → MQLPDCPCRAHLP

Show »
Length:753
Mass (Da):86,696
Checksum:iA67868CBD2FFD9A7
GO
Isoform 3 (identifier: Q9UKW4-3) [UniParc]FASTAAdd to basket
Also known as: VAV3.1

The sequence of this isoform differs from the canonical sequence as follows:
     1-560: Missing.
     561-568: NCGRVNSG → MPIFTFLS

Note: May be produced by alternative promoter usage.
Show »
Length:287
Mass (Da):32,604
Checksum:iD23C21EBEF7F48CF
GO
Isoform 4 (identifier: Q9UKW4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     783-784: SL → SSPSLFCGFSFVTPPDYSFVPPSSTPFWSV

Note: No experimental confirmation available.
Show »
Length:875
Mass (Da):100,828
Checksum:iAD6B651338EEE812
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDG2H0YDG2_HUMAN
Guanine nucleotide exchange factor ...
VAV3
616Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCG7H0YCG7_HUMAN
Guanine nucleotide exchange factor ...
VAV3
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMJ5E9PMJ5_HUMAN
Guanine nucleotide exchange factor ...
VAV3
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD03799 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti107K → E in AAC79695 (PubMed:9705494).Curated1
Sequence conflicti217Y → H in AAD20348 (PubMed:10523675).Curated1
Sequence conflicti429V → A in AAD20348 (PubMed:10523675).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061800139D → N. Corresponds to variant dbSNP:rs34318889Ensembl.1
Natural variantiVAR_033522298T → S2 PublicationsCorresponds to variant dbSNP:rs7528153Ensembl.1
Natural variantiVAR_051998616P → S. Corresponds to variant dbSNP:rs12410676Ensembl.1
Natural variantiVAR_033523618Q → H. Corresponds to variant dbSNP:rs12403266Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0413601 – 560Missing in isoform 3. 2 PublicationsAdd BLAST560
Alternative sequenceiVSP_0018201 – 107MEPWK…RDFGK → MQLPDCPCRAHLP in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_041361561 – 568NCGRVNSG → MPIFTFLS in isoform 3. 2 Publications8
Alternative sequenceiVSP_042359783 – 784SL → SSPSLFCGFSFVTPPDYSFV PPSSTPFWSV in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF035442 mRNA Translation: AAD03799.1 Different initiation.
AF067817 mRNA Translation: AAC79695.1
AF118887 mRNA Translation: AAD20349.1
AF118886 mRNA Translation: AAD20348.1
AK304088 mRNA Translation: BAG64994.1
AK316295 mRNA Translation: BAH14666.1
AC114491 Genomic DNA No translation available.
AL353892 Genomic DNA No translation available.
AL391235 Genomic DNA No translation available.
AL513206 Genomic DNA No translation available.
AL591042 Genomic DNA No translation available.
CH471156 Genomic DNA Translation: EAW51252.1
BC143969 mRNA Translation: AAI43970.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44181.1 [Q9UKW4-3]
CCDS785.1 [Q9UKW4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001073343.1, NM_001079874.1 [Q9UKW4-3]
NP_006104.4, NM_006113.4 [Q9UKW4-1]
XP_005270417.1, XM_005270360.2 [Q9UKW4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370056; ENSP00000359073; ENSG00000134215 [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215 [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215 [Q9UKW4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10451

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10451

UCSC genome browser

More...
UCSCi
uc001dvj.2 human [Q9UKW4-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF035442 mRNA Translation: AAD03799.1 Different initiation.
AF067817 mRNA Translation: AAC79695.1
AF118887 mRNA Translation: AAD20349.1
AF118886 mRNA Translation: AAD20348.1
AK304088 mRNA Translation: BAG64994.1
AK316295 mRNA Translation: BAH14666.1
AC114491 Genomic DNA No translation available.
AL353892 Genomic DNA No translation available.
AL391235 Genomic DNA No translation available.
AL513206 Genomic DNA No translation available.
AL591042 Genomic DNA No translation available.
CH471156 Genomic DNA Translation: EAW51252.1
BC143969 mRNA Translation: AAI43970.1
CCDSiCCDS44181.1 [Q9UKW4-3]
CCDS785.1 [Q9UKW4-1]
RefSeqiNP_001073343.1, NM_001079874.1 [Q9UKW4-3]
NP_006104.4, NM_006113.4 [Q9UKW4-1]
XP_005270417.1, XM_005270360.2 [Q9UKW4-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D86NMR-A1-130[»]
SMRiQ9UKW4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi115715, 18 interactors
IntActiQ9UKW4, 15 interactors
MINTiQ9UKW4
STRINGi9606.ENSP00000359073

PTM databases

iPTMnetiQ9UKW4
PhosphoSitePlusiQ9UKW4

Polymorphism and mutation databases

BioMutaiVAV3
DMDMi12643372

Proteomic databases

EPDiQ9UKW4
jPOSTiQ9UKW4
PaxDbiQ9UKW4
PeptideAtlasiQ9UKW4
PRIDEiQ9UKW4
ProteomicsDBi84896 [Q9UKW4-1]
84897 [Q9UKW4-2]
84898 [Q9UKW4-3]
84899 [Q9UKW4-4]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q9UKW4

The DNASU plasmid repository

More...
DNASUi
10451
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370056; ENSP00000359073; ENSG00000134215 [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215 [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215 [Q9UKW4-4]
GeneIDi10451
KEGGihsa:10451
UCSCiuc001dvj.2 human [Q9UKW4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10451
DisGeNETi10451

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VAV3
HGNCiHGNC:12659 VAV3
HPAiCAB002012
MIMi605541 gene
neXtProtiNX_Q9UKW4
OpenTargetsiENSG00000134215
PharmGKBiPA37282

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2996 Eukaryota
ENOG410XPH6 LUCA
GeneTreeiENSGT00940000155252
HOGENOMiHOG000234364
InParanoidiQ9UKW4
KOiK05730
OMAiHEFKMHT
OrthoDBi710582at2759
PhylomeDBiQ9UKW4
TreeFamiTF316171

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-2424491 DAP12 signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-3928665 EPH-ephrin mediated repulsion of cells
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5218920 VEGFR2 mediated vascular permeability
SignaLinkiQ9UKW4
SIGNORiQ9UKW4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
VAV3 human
EvolutionaryTraceiQ9UKW4

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
VAV3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10451

Protein Ontology

More...
PROi
PR:Q9UKW4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134215 Expressed in 203 organ(s), highest expression level in tongue squamous epithelium
ExpressionAtlasiQ9UKW4 baseline and differential
GenevisibleiQ9UKW4 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd00014 CH, 1 hit
cd01223 PH_Vav, 1 hit
cd00160 RhoGEF, 1 hit
cd10407 SH2_Vav3, 1 hit
cd11978 SH3_VAV3_2, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR022613 CAMSAP_CH
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037832 PH_Vav
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003096 SM22_calponin
IPR035881 VAV3_SH2
IPR035734 VAV3_SH3_2
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF11971 CAMSAP_CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00017 SH2, 1 hit
PF07653 SH3_2, 2 hits
PRINTSiPR00401 SH2DOMAIN
PR00452 SH3DOMAIN
PR00888 SM22CALPONIN
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00252 SH2, 1 hit
SM00326 SH3, 2 hits
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 2 hits
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit
PS50002 SH3, 2 hits
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVAV3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UKW4
Secondary accession number(s): B1AMM0
, B1APV5, B4E232, B7ZLR1, E9PQ97, O60498, O95230, Q9Y5X8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 1, 2000
Last modified: July 31, 2019
This is version 190 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again